CPQ (Myc-DDK-tagged)-Human plasma glutamate carboxypeptidase (PGCP)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CPQ (Myc-DDK-tagged)-Human plasma glutamate carboxypeptidase (PGCP)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human plasma glutamate carboxypeptidase (PGCP)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
CPQ (GFP-tagged) - Human plasma glutamate carboxypeptidase (PGCP)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human plasma glutamate carboxypeptidase (PGCP), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CPQ (Myc-DDK tagged) - Human plasma glutamate carboxypeptidase (PGCP), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human plasma glutamate carboxypeptidase (PGCP), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CPQ (mGFP-tagged) - Human plasma glutamate carboxypeptidase (PGCP), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-PGCP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PGCP antibody: synthetic peptide directed towards the N terminal of human PGCP. Synthetic peptide located within the following region: VDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESA |
Recombinant protein of human plasma glutamate carboxypeptidase (PGCP), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
Tag | N-His |
Expression Host | E. coli |
CPQ HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CPQ (untagged)-Human plasma glutamate carboxypeptidase (PGCP)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal antibody to PGCP
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 19 and 296 of PGCP (Uniprot ID#Q9Y646) |
Transient overexpression lysate of plasma glutamate carboxypeptidase (PGCP)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PGCP MS Standard C13 and N15-labeled recombinant protein (NP_057218)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Transient overexpression of CPQ (NM_016134) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CPQ (NM_016134) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CPQ (NM_016134) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack