Products

View as table Download

CPQ (Myc-DDK-tagged)-Human plasma glutamate carboxypeptidase (PGCP)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

CPQ (GFP-tagged) - Human plasma glutamate carboxypeptidase (PGCP)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human plasma glutamate carboxypeptidase (PGCP), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human plasma glutamate carboxypeptidase (PGCP), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit Polyclonal Anti-PGCP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PGCP antibody: synthetic peptide directed towards the N terminal of human PGCP. Synthetic peptide located within the following region: VDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESA

Recombinant protein of human plasma glutamate carboxypeptidase (PGCP), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli

CPQ HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

CPQ (untagged)-Human plasma glutamate carboxypeptidase (PGCP)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit polyclonal antibody to PGCP

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 19 and 296 of PGCP (Uniprot ID#Q9Y646)

Transient overexpression lysate of plasma glutamate carboxypeptidase (PGCP)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

PGCP MS Standard C13 and N15-labeled recombinant protein (NP_057218)

Tag C-Myc/DDK
Expression Host HEK293

Transient overexpression of CPQ (NM_016134) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of CPQ (NM_016134) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of CPQ (NM_016134) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack