Products

cDNA Clones (40)
Antibodies (16)
Proteins (15)
Jump to Filters
View as table Download
DPP10 (NM_020868) Human Tagged ORF Clone
RC205435

USD 420.00

In Stock

DPP10 (Myc-DDK-tagged)-Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
DPP10 (NM_020868) Human Tagged ORF Clone Lentiviral Particle
RC205435L1V

USD 820.00

3 Weeks

Lenti ORF particles, DPP10 (Myc-DDK tagged) - Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
DPP10 (NM_020868) Human Tagged ORF Clone Lentiviral Particle
RC205435L2V

USD 820.00

6 Weeks

Lenti ORF particles, DPP10 (mGFP-tagged) - Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
DPP10 (NM_020868) Human Tagged ORF Clone
RG205435

USD 460.00

In Stock

DPP10 (GFP-tagged) - Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DPP10 (NM_020868) Human Tagged ORF Clone
RC205435L3

USD 620.00

3 Weeks

Lenti ORF clone of Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DPP10 (NM_020868) Human Tagged ORF Clone Lentiviral Particle
RC205435L3V

USD 820.00

5 Weeks

Lenti ORF particles, DPP10 (Myc-DDK tagged) - Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DPP10 (NM_020868) Human Tagged ORF Clone
RC205435L4

USD 620.00

3 Weeks

Lenti ORF clone of Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DPP10 (NM_020868) Human Tagged ORF Clone Lentiviral Particle
RC205435L4V

USD 820.00

7 Weeks

Lenti ORF particles, DPP10 (mGFP-tagged) - Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DPP10 (NM_001004360) Human Tagged ORF Clone
RC221061

USD 880.00

3 Weeks

DPP10 (Myc-DDK-tagged)-Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
DPP10 (NM_001004360) Human Tagged ORF Clone
RC221061L3

USD 1,080.00

4 Weeks

Lenti-ORF clone of DPP10 (Myc-DDK-tagged)-Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DPP10 (NM_001004360) Human Tagged ORF Clone Lentiviral Particle
RC221061L3V

USD 1,280.00

7 Weeks

Lenti ORF particles, DPP10 (Myc-DDK-tagged)-Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DPP10 (NM_001004360) Human Tagged ORF Clone
RC221061L4

USD 1,080.00

4 Weeks

Lenti-ORF clone of DPP10 (mGFP-tagged)-Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DPP10 (NM_001004360) Human Tagged ORF Clone Lentiviral Particle
RC221061L4V

USD 1,280.00

7 Weeks

Lenti ORF particles, DPP10 (mGFP-tagged)-Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DPP10 (NM_001178036) Human Tagged ORF Clone
RC230475

USD 420.00

4 Weeks

DPP10 (Myc-DDK-tagged)-Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
DPP10 (NM_001178036) Human Tagged ORF Clone
RC230475L3

USD 620.00

4 Weeks

Lenti-ORF clone of DPP10 (Myc-DDK-tagged)-Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 5

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DPP10 (NM_001178036) Human Tagged ORF Clone Lentiviral Particle
RC230475L3V

USD 820.00

7 Weeks

Lenti ORF particles, DPP10 (Myc-DDK-tagged)-Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DPP10 (NM_001178036) Human Tagged ORF Clone
RC230475L4

USD 620.00

4 Weeks

Lenti-ORF clone of DPP10 (mGFP-tagged)-Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 5

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DPP10 (NM_001178036) Human Tagged ORF Clone Lentiviral Particle
RC230475L4V

USD 820.00

7 Weeks

Lenti ORF particles, DPP10 (mGFP-tagged)-Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DPP10 (NM_001178037) Human Tagged ORF Clone
RC230500

USD 880.00

3 Weeks

DPP10 (Myc-DDK-tagged)-Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
DPP10 (NM_001178037) Human Tagged ORF Clone
RC230500L3

USD 1,080.00

4 Weeks

Lenti-ORF clone of DPP10 (Myc-DDK-tagged)-Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DPP10 (NM_001178037) Human Tagged ORF Clone Lentiviral Particle
RC230500L3V

USD 1,280.00

7 Weeks

Lenti ORF particles, DPP10 (Myc-DDK-tagged)-Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DPP10 (NM_001178037) Human Tagged ORF Clone
RC230500L4

USD 1,080.00

4 Weeks

Lenti-ORF clone of DPP10 (mGFP-tagged)-Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DPP10 (NM_001178037) Human Tagged ORF Clone Lentiviral Particle
RC230500L4V

USD 1,280.00

7 Weeks

Lenti ORF particles, DPP10 (mGFP-tagged)-Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DPP10 (NM_001178034) Human Tagged ORF Clone
RC230501

USD 890.00

3 Weeks

DPP10 (Myc-DDK-tagged)-Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
DPP10 (NM_001178034) Human Tagged ORF Clone
RC230501L3

USD 1,090.00

4 Weeks

Lenti-ORF clone of DPP10 (Myc-DDK-tagged)-Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DPP10 (NM_001178034) Human Tagged ORF Clone Lentiviral Particle
RC230501L3V

USD 1,290.00

7 Weeks

Lenti ORF particles, DPP10 (Myc-DDK-tagged)-Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DPP10 (NM_001178034) Human Tagged ORF Clone
RC230501L4

USD 1,090.00

4 Weeks

Lenti-ORF clone of DPP10 (mGFP-tagged)-Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DPP10 (NM_001178034) Human Tagged ORF Clone Lentiviral Particle
RC230501L4V

USD 1,290.00

7 Weeks

Lenti ORF particles, DPP10 (mGFP-tagged)-Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DPP10 (NM_001004360) Human Tagged ORF Clone
RG221061

USD 970.00

5 Weeks

DPP10 (GFP-tagged) - Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DPP10 (NM_001178036) Human Tagged ORF Clone
RG230475

USD 460.00

5 Weeks

DPP10 (GFP-tagged) - Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DPP10 (NM_001178037) Human Tagged ORF Clone
RG230500

USD 970.00

5 Weeks

DPP10 (GFP-tagged) - Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DPP10 (NM_001178034) Human Tagged ORF Clone
RG230501

USD 980.00

5 Weeks

DPP10 (GFP-tagged) - Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DPP10 (NM_020868) Human Tagged ORF Clone
RC205435L1

USD 768.00

In Stock

Lenti ORF clone of Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
DPP10 (NM_020868) Human Tagged ORF Clone
RC205435L2

USD 620.00

3 Weeks

Lenti ORF clone of Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
DPP10 (NM_020868) Human Untagged Clone
SC118887

USD 760.00

In Stock

DPP10 (untagged)-Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
SC118887 is the updated version of SC125383.
DPP10 (NM_001004360) Human Untagged Clone
SC300671

USD 1,600.00

In Stock

DPP10 (untagged)-Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
DPP10 (NM_020868) Human Over-expression Lysate
LC412236

USD 121.00

In Stock

DPP10 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
DPP10 (NM_020868) Human Over-expression Lysate
LY412236

USD 396.00

5 Days

Transient overexpression lysate of dipeptidyl-peptidase 10 (DPP10), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
DPP10 Goat Polyclonal Antibody
TA303024

USD 375.00

5 Days

Goat Polyclonal Antibody against DPP10

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DEGHNVSEKSKYHL, from the internal region of the protein sequence according to NP_065919.2; NP_001004360.1.
DPP10 Rabbit Polyclonal Antibody
TA309628

USD 350.00

5 Days

Rabbit Polyclonal DPP10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to residues 521-539 of human DPP10.
DPP10 Rabbit Polyclonal Antibody
TA335318

USD 375.00

5 Days

Rabbit Polyclonal Anti-DPP10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DPP10 antibody: synthetic peptide directed towards the middle region of human DPP10. Synthetic peptide located within the following region: VNYTMQVYPDEGHNVSEKSKYHLYSTILKFFSDCLKEEISVLPQEPEEDE
DPP10 Rabbit Polyclonal Antibody
TA341137

USD 425.00

5 Days

Rabbit Polyclonal Anti-DPP10 Antibody (Extracellular Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Dipeptidylpeptidase 10 / DPP10 antibody was raised against synthetic 14 amino acid peptide from extracellular domain of human DPP10. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig (100%); Mouse, Rat, Hamster (93%); Opossum, Chicken (86%).
DPP10 Rabbit Polyclonal Antibody
TA341140

USD 425.00

5 Days

Rabbit Polyclonal Anti-DPP10 Antibody (Extracellular Domain)

Applications IHC
Reactivities Human
Immunogen Dipeptidylpeptidase 10 / DPP10 antibody was raised against synthetic 15 amino acid peptide from extracellular domain of human DPP10. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Bovine, Panda, Horse, Rabbit, Pig (100%); Gibbon, Dog (93%); Bat, Elephant (87%).
DPP10 Rabbit Polyclonal Antibody
TA341253

USD 425.00

5 Days

Rabbit Polyclonal Anti-DPP10 Antibody (Internal)

Applications IHC
Reactivities Human
Immunogen Dipeptidylpeptidase 10 / DPP10 antibody was raised against synthetic 17 amino acid peptide from internal region of human DPP10. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Panda, Bovine, Dog, Horse, Guinea pig (100%); Galago, Bat, Rabbit, Pig (94%); Opossum, Turkey, Zebra finch, Chicken, Xenopus (88%); Mouse, Rat, Hamster, Elephant (82%).
DPP10 Mouse Monoclonal Antibody [Clone ID: OTI1A5]
CF503585

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) DPP10 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
DPP10 Mouse Monoclonal Antibody [Clone ID: OTI2A5]
CF503640

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) DPP10 mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
DPP10 (NM_020868) Human Mass Spec Standard
PH305435

USD 2,055.00

3 Weeks

DPP10 MS Standard C13 and N15-labeled recombinant protein (NP_065919)

Tag C-Myc/DDK
Expression Host HEK293
DPP10 (AK055256) Human Untagged Clone
SC311736

USD 960.00

3 Weeks

(untagged)-Human cDNA FLJ30694 fis, clone FCBBF2000733, weakly similar to DIPEPTIDYL PEPTIDASE IV LIKE PROTEIN

Vector pCMV6 series
Tag Tag Free
DPP10 (NM_001178036) Human Untagged Clone
SC329113

USD 760.00

5 Weeks

DPP10 (untagged)-Human dipeptidyl-peptidase 10 (non-functional) (DPP10) transcript variant 5

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None