Products

cDNA Clones (16)
Proteins (9)
Antibodies (7)
Jump to Filters
View as table Download
Presenilin 1 (PSEN1) (NM_000021) Human Untagged Clone
SC125532

USD 780.00

In Stock

PSEN1 (untagged)-Human presenilin 1 (PSEN1), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Presenilin 1 (PSEN1) (NM_000021) Human Tagged ORF Clone
RG216443

USD 460.00

In Stock

PSEN1 (GFP-tagged) - Human presenilin 1 (PSEN1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Presenilin 1 (PSEN1) (NM_007318) Human Tagged ORF Clone
RC225783

USD 420.00

In Stock

PSEN1 (Myc-DDK-tagged)-Human presenilin 1 (PSEN1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Presenilin 1 (PSEN1) (NM_007318) Human Tagged ORF Clone
RC225783L3

USD 620.00

3 Weeks

Lenti-ORF clone of PSEN1 (Myc-DDK-tagged)-Human presenilin 1 (PSEN1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Presenilin 1 (PSEN1) (NM_007318) Human Tagged ORF Clone
RC225783L4

USD 620.00

3 Weeks

Lenti-ORF clone of PSEN1 (mGFP-tagged)-Human presenilin 1 (PSEN1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Presenilin 1 (PSEN1) (NM_007318) Human Tagged ORF Clone
RG225783

USD 460.00

3 Weeks

PSEN1 (GFP-tagged) - Human presenilin 1 (PSEN1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Presenilin 1 (PSEN1) Rabbit Polyclonal Antibody
TA306424

USD 430.00

In Stock

Rabbit Polyclonal Presenilin1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Presenilin1 antibody was raised against a 23 amino acid peptide from near the carboxy terminus of human presenilin1.
Presenilin 1 (PSEN1) (NM_000021) Human Over-expression Lysate
LY424973

USD 396.00

In Stock

Transient overexpression lysate of presenilin 1 (PSEN1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Presenilin 1 (PSEN1) (NM_000021) Human Tagged ORF Clone
RC216443L2

USD 620.00

In Stock

Lenti ORF clone of Human presenilin 1 (PSEN1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Presenilin 1 (PSEN1) Rabbit Polyclonal Antibody
TA313388

USD 345.00

In Stock

Rabbit polyclonal Presenilin 1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human presenilin 1.
Presenilin 1 (PSEN1) Rabbit Polyclonal Antibody
TA347463

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Presenilin 1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Presenilin 1 Antibody: A synthesized peptide derived from human Presenilin 1
Presenilin 1 (PSEN1) (NM_000021) Human Over-expression Lysate
LC424973

USD 121.00

In Stock

PSEN1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Presenilin 1 (PSEN1) Rabbit Polyclonal Antibody
TA334642

USD 375.00

5 Days

Rabbit Polyclonal Anti-PSEN1 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PSEN1 antibody: synthetic peptide directed towards the N terminal of human PSEN1. Synthetic peptide located within the following region: TRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKY
Presenilin 1 (PSEN1) Rabbit Polyclonal Antibody
TA336586

USD 350.00

5 Days

Rabbit Polyclonal Presenilin-1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptides corresponding to the N terminal sequence MVELMFP and the C terminal sequence LLGLPID of the human Presenilin 1 protein.
Presenilin 1 (PSEN1) Rabbit Polyclonal Antibody
TA354271

USD 355.00

5 Days

Rabbit anti Presenillin Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated
Presenilin 1 (PSEN1) (NM_000021) Human Mass Spec Standard
PH316443

USD 2,055.00

3 Weeks

PSEN1 MS Standard C13 and N15-labeled recombinant protein (NP_000012)

Tag C-Myc/DDK
Expression Host HEK293
Presenilin 1 (PSEN1) Rabbit Polyclonal Antibody
TA357492

USD 360.00

5 Days

PSEN1 Antibody - middle region

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PSEN1
Presenilin 1 (PSEN1) ICC Control Block
TB416443

USD 1,070.00

4 Weeks

Transient overexpression of PSEN1 (NM_000021) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Presenilin 1 (PSEN1) ICC Control Block
TB425783

USD 1,070.00

4 Weeks

Transient overexpression of PSEN1 (NM_007318) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Presenilin 1 (PSEN1) Cytosection
TS416443

USD 225.00

4 Weeks

Transient overexpression of PSEN1 (NM_000021) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Presenilin 1 (PSEN1) Cytosection
TS416443P5

USD 889.00

4 Weeks

Transient overexpression of PSEN1 (NM_000021) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Presenilin 1 (PSEN1) Cytosection
TS425783

USD 225.00

4 Weeks

Transient overexpression of PSEN1 (NM_007318) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Presenilin 1 (PSEN1) Cytosection
TS425783P5

USD 889.00

4 Weeks

Transient overexpression of PSEN1 (NM_007318) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack