PSEN1 (Myc-DDK-tagged)-Human presenilin 1 (PSEN1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PSEN1 (Myc-DDK-tagged)-Human presenilin 1 (PSEN1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PSEN1 (untagged)-Human presenilin 1 (PSEN1), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
PSEN1 (GFP-tagged) - Human presenilin 1 (PSEN1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, PSEN1 (mGFP-tagged) - Human presenilin 1 (PSEN1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 820.00
3 Weeks
Lenti ORF particles, PSEN1 (Myc-DDK tagged) - Human presenilin 1 (PSEN1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
PSEN1 (Myc-DDK-tagged)-Human presenilin 1 (PSEN1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 820.00
5 Weeks
Lenti ORF particles, PSEN1 (Myc-DDK tagged) - Human presenilin 1 (PSEN1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human presenilin 1 (PSEN1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, PSEN1 (mGFP-tagged) - Human presenilin 1 (PSEN1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PSEN1 (Myc-DDK-tagged)-Human presenilin 1 (PSEN1), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, PSEN1 (Myc-DDK-tagged)-Human presenilin 1 (PSEN1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PSEN1 (mGFP-tagged)-Human presenilin 1 (PSEN1), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, PSEN1 (mGFP-tagged)-Human presenilin 1 (PSEN1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PSEN1 (GFP-tagged) - Human presenilin 1 (PSEN1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Presenilin1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Presenilin1 antibody was raised against a 23 amino acid peptide from near the carboxy terminus of human presenilin1. |
Transient overexpression lysate of presenilin 1 (PSEN1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human presenilin 1 (PSEN1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal Presenilin 1 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human presenilin 1. |
Rabbit Polyclonal Anti-Presenilin 1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Presenilin 1 Antibody: A synthesized peptide derived from human Presenilin 1 |
PSEN1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-PSEN1 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PSEN1 antibody: synthetic peptide directed towards the N terminal of human PSEN1. Synthetic peptide located within the following region: TRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKY |
Rabbit Polyclonal Presenilin-1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptides corresponding to the N terminal sequence MVELMFP and the C terminal sequence LLGLPID of the human Presenilin 1 protein. |
Rabbit anti Presenillin Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
PSEN1 MS Standard C13 and N15-labeled recombinant protein (NP_000012)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
PSEN1 Antibody - middle region
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PSEN1 |
Transient overexpression of PSEN1 (NM_000021) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PSEN1 (NM_007318) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PSEN1 (NM_000021) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PSEN1 (NM_000021) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PSEN1 (NM_007318) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PSEN1 (NM_007318) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack