Products

View as table Download

USD 98.00

USD 390.00

In Stock

PSMA1 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, PSMA1 (Myc-DDK tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, PSMA1 (mGFP-tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

PSMA1 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PSMA1 (GFP-tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PSMA1 (Myc-DDK tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PSMA1 (mGFP-tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PSMA1 (Myc-DDK tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PSMA1 (mGFP-tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PSMA1 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of PSMA1 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PSMA1 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of PSMA1 (mGFP-tagged)-Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PSMA1 (mGFP-tagged)-Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PSMA1 (GFP-tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PSMA1 (GFP-tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit Polyclonal Anti-PSMA1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMA1 antibody: synthetic peptide directed towards the C terminal of human PSMA1. Synthetic peptide located within the following region: TYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDL

Recombinant protein of human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli

Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Rabbit anti-PSMA1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PSMA1

Rabbit Polyclonal Anti-PSMA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMA1 antibody: synthetic peptide directed towards the N terminal of human PSMA1. Synthetic peptide located within the following region: MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALK

PSMA1 (untagged)-Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
SC109640 is the updated version of SC125401.

PSMA1 (untagged)-Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

PSMA1 (1-263, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli

PSMA1 (1-263, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli

Carrier-free (BSA/glycerol-free) PSMA1 mouse monoclonal antibody,clone OTI9H1

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PSMA1 mouse monoclonal antibody,clone OTI6C4

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PSMA1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

PSMA1 (untagged)-Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

PSMA1 (untagged)-Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 3

Vector pCMV6 series
Tag Tag Free

PSMA1 mouse monoclonal antibody,clone OTI9H1

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PSMA1 mouse monoclonal antibody,clone OTI9H1

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PSMA1 mouse monoclonal antibody,clone OTI6C4

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PSMA1 mouse monoclonal antibody,clone OTI6C4

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

USD 1,040.00

4 Weeks

Transient overexpression of PSMA1 (NM_002786) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,070.00

4 Weeks

Transient overexpression of PSMA1 (NM_148976) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,070.00

4 Weeks

Transient overexpression of PSMA1 (NM_001143937) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of PSMA1 (NM_002786) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of PSMA1 (NM_002786) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of PSMA1 (NM_148976) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack