Products

cDNA Clones (42)
Antibodies (16)
Proteins (13)
RNAi (12)
Gene Expression (7)
Jump to Filters
View as table Download
PSMA1 (NM_002786) Human Tagged ORF Clone
RC203260

USD 98.00

USD 390.00

In Stock

PSMA1 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PSMA1 (NM_002786) Human Tagged ORF Clone Lentiviral Particle
RC203260L1V

USD 820.00

3 Weeks

Lenti ORF particles, PSMA1 (Myc-DDK tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PSMA1 (NM_002786) Human Tagged ORF Clone Lentiviral Particle
RC203260L2V

USD 820.00

In Stock

Lenti ORF particles, PSMA1 (mGFP-tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PSMA1 (NM_148976) Human Tagged ORF Clone
RC211847

USD 420.00

In Stock

PSMA1 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Psma1 (NM_011965) Mouse Tagged ORF Clone
MR203461

USD 68.00

USD 219.00

In Stock

Psma1 (Myc-DDK-tagged) - Mouse proteasome (prosome, macropain) subunit, alpha type 1 (Psma1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PSMA1 (NM_002786) Human Tagged ORF Clone
RG203260

USD 460.00

In Stock

PSMA1 (GFP-tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PSMA1 Human Gene Knockout Kit (CRISPR)
KN403260

USD 1,290.00

2 Weeks

PSMA1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN403260 is the updated version of KN203260.
Psma1 Mouse Gene Knockout Kit (CRISPR)
KN514089

USD 1,290.00

2 Weeks

Psma1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN514089 is the updated version of KN314089.
Psma1 (NM_011965) Mouse Tagged ORF Clone
MG203461

USD 300.00

3 Weeks

Psma1 (GFP-tagged) - Mouse proteasome (prosome, macropain) subunit, alpha type 1 (Psma1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Psma1 (NM_011965) Mouse Tagged ORF Clone
MR203461L3

USD 500.00

3 Weeks

Lenti ORF clone of Psma1 (Myc-DDK-tagged) - Mouse proteasome (prosome, macropain) subunit, alpha type 1 (Psma1)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Psma1 (NM_011965) Mouse Tagged ORF Clone Lentiviral Particle
MR203461L3V

USD 700.00

6 Weeks

Lenti ORF particles, Psma1 (Myc-DDK-tagged) - Mouse proteasome (prosome, macropain) subunit, alpha type 1 (Psma1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Psma1 (NM_011965) Mouse Tagged ORF Clone
MR203461L4

USD 500.00

3 Weeks

Lenti ORF clone of Psma1 (mGFP-tagged) - Mouse proteasome (prosome, macropain) subunit, alpha type 1 (Psma1)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Psma1 (NM_011965) Mouse Tagged ORF Clone Lentiviral Particle
MR203461L4V

USD 700.00

6 Weeks

Lenti ORF particles, Psma1 (GFP-tagged) - Mouse proteasome (prosome, macropain) subunit, alpha type 1 (Psma1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA1 (NM_002786) Human Tagged ORF Clone
RC203260L3

USD 620.00

3 Weeks

Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA1 (NM_002786) Human Tagged ORF Clone Lentiviral Particle
RC203260L3V

USD 820.00

5 Weeks

Lenti ORF particles, PSMA1 (Myc-DDK tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA1 (NM_002786) Human Tagged ORF Clone
RC203260L4

USD 620.00

3 Weeks

Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA1 (NM_002786) Human Tagged ORF Clone Lentiviral Particle
RC203260L4V

USD 820.00

7 Weeks

Lenti ORF particles, PSMA1 (mGFP-tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA1 (NM_148976) Human Tagged ORF Clone
RC211847L3

USD 620.00

3 Weeks

Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA1 (NM_148976) Human Tagged ORF Clone Lentiviral Particle
RC211847L3V

USD 820.00

6 Weeks

Lenti ORF particles, PSMA1 (Myc-DDK tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA1 (NM_148976) Human Tagged ORF Clone
RC211847L4

USD 620.00

3 Weeks

Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA1 (NM_148976) Human Tagged ORF Clone Lentiviral Particle
RC211847L4V

USD 820.00

6 Weeks

Lenti ORF particles, PSMA1 (mGFP-tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA1 (NM_001143937) Human Tagged ORF Clone
RC226679

USD 420.00

2 Weeks

PSMA1 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PSMA1 (NM_001143937) Human Tagged ORF Clone
RC226679L3

USD 620.00

8 Weeks

Lenti-ORF clone of PSMA1 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA1 (NM_001143937) Human Tagged ORF Clone Lentiviral Particle
RC226679L3V

USD 820.00

11 Weeks

Lenti ORF particles, PSMA1 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA1 (NM_001143937) Human Tagged ORF Clone
RC226679L4

USD 620.00

8 Weeks

Lenti-ORF clone of PSMA1 (mGFP-tagged)-Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA1 (NM_001143937) Human Tagged ORF Clone Lentiviral Particle
RC226679L4V

USD 820.00

11 Weeks

Lenti ORF particles, PSMA1 (mGFP-tagged)-Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA1 (NM_148976) Human Tagged ORF Clone
RG211847

USD 460.00

3 Weeks

PSMA1 (GFP-tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PSMA1 (NM_001143937) Human Tagged ORF Clone
RG226679

USD 460.00

3 Weeks

PSMA1 (GFP-tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Psma1 (NM_017278) Rat Tagged ORF Clone
RR205915

USD 420.00

4 Weeks

Psma1 (Myc-DDK-tagged ORF) - Rat proteasome (prosome, macropain) subunit, alpha type 1 (Psma1), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Psma1 (NM_017278) Rat Tagged ORF Clone
RR205915L3

USD 640.00

8 Weeks

Lenti ORF clone of Psma1 (Myc-DDK-tagged ORF) - Rat proteasome (prosome, macropain) subunit, alpha type 1 (Psma1), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Psma1 (NM_017278) Rat Tagged ORF Clone Lentiviral Particle
RR205915L3V

USD 850.00

12 Weeks

Lenti ORF particles, Psma1 (Myc-DDK-tagged ORF) - Rat proteasome (prosome, macropain) subunit, alpha type 1 (Psma1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Psma1 (NM_017278) Rat Tagged ORF Clone
RR205915L4

USD 700.00

8 Weeks

Lenti ORF clone of Psma1 (mGFP-tagged ORF) - Rat proteasome (prosome, macropain) subunit, alpha type 1 (Psma1), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Psma1 (NM_017278) Rat Tagged ORF Clone Lentiviral Particle
RR205915L4V

USD 960.00

12 Weeks

Lenti ORF particles, Psma1 (GFP-tagged ORF) - Rat proteasome (prosome, macropain) subunit, alpha type 1 (Psma1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA1 Rabbit Polyclonal Antibody
TA345809

USD 475.00

5 Days

Rabbit Polyclonal Anti-PSMA1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMA1 antibody: synthetic peptide directed towards the C terminal of human PSMA1. Synthetic peptide located within the following region: TYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDL
PSMA1 (NM_002786) Human Recombinant Protein
TP760007

USD 215.00

In Stock

Recombinant protein of human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
PSMA1 (NM_002786) Human Tagged ORF Clone
RC203260L1

USD 620.00

In Stock

Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PSMA1 (NM_002786) Human Tagged ORF Clone
RC203260L2

USD 620.00

In Stock

Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PSMA1 Rabbit Polyclonal Antibody
TA332538

USD 275.00

3 Weeks

Rabbit anti-PSMA1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PSMA1
PSMA1 (NM_002786) Human Over-expression Lysate
LY419114

USD 396.00

5 Days

Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PSMA1 Rabbit Polyclonal Antibody
TA345810

USD 410.00

5 Days

Rabbit Polyclonal Anti-PSMA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMA1 antibody: synthetic peptide directed towards the N terminal of human PSMA1. Synthetic peptide located within the following region: MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALK
Psma1 (BC005762) Mouse Untagged Clone
MC200285

USD 210.00

In Stock

Psma1 (untagged) - Mouse proteasome (prosome, macropain) subunit, alpha type 1 (cDNA clone MGC:6546 IMAGE:2655483), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
PSMA1 (NM_002786) Human Untagged Clone
SC109640

USD 420.00

In Stock

PSMA1 (untagged)-Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
SC109640 is the updated version of SC125401.
PSMA1 (NM_002786) Human Untagged Clone
SC320849

USD 420.00

In Stock

PSMA1 (untagged)-Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
PSMA1 Human shRNA Plasmid Kit (Locus ID 5682)
TL302230

USD 815.00

In Stock

PSMA1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
E. coli Selection Chloramphenicol
Mammalian Cell Selection Puromycin
PSMA1 Human shRNA Lentiviral Particle (Locus ID 5682)
TL302230V

USD 1,395.00

In Stock

PSMA1 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti
PSMA1 (1-263, His-tag) Human Protein
AR50066PU-N

USD 845.00

2 Weeks

PSMA1 (1-263, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
PSMA1 (1-263, His-tag) Human Protein
AR50066PU-S

USD 330.00

2 Weeks

PSMA1 (1-263, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
PSMA1 Mouse Monoclonal Antibody [Clone ID: OTI9H1]
CF812757

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PSMA1 mouse monoclonal antibody,clone OTI9H1

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PSMA1 Mouse Monoclonal Antibody [Clone ID: OTI6C4]
CF812761

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PSMA1 mouse monoclonal antibody,clone OTI6C4

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Human PSMA1 activation kit by CRISPRa
GA103851

USD 1,290.00

2 Weeks

PSMA1 CRISPRa kit - CRISPR gene activation of human proteasome subunit alpha 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector