Germany
Japan
United Kingdom
China
UCHL3 (Myc-DDK-tagged)-Human ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, UCHL3 (Myc-DDK tagged) - Human ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, UCHL3 (mGFP-tagged) - Human ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
UCHL3 (GFP-tagged) - Human ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, UCHL3 (Myc-DDK tagged) - Human ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, UCHL3 (mGFP-tagged) - Human ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
UCHL3 (Myc-DDK tagged) - Homo sapiens ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
UCHL3 (GFP-tagged) - Homo sapiens ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Rabbit Polyclonal Anti-UCHL3 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UCHL3 antibody: synthetic peptide directed towards the N terminal of human UCHL3. Synthetic peptide located within the following region: MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVC |
Lenti ORF clone of Human ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
UCHL3 (untagged)-Human ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
UCHL3 (1-230, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
UCHL3 (1-230, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
Lenti ORF clone of Human ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
UCHL3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression lysate of ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-UCHL3 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | UCHL3 antibody was raised against synthetic 15 amino acid peptide from near C-terminus of human UCHL3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Horse, Rabbit, Pig, Lizard (100%); Opossum, Turkey, Chicken (93%); Xenopus, Zebrafish, Drosophila (80%). |
Rabbit Polyclonal Anti-UCHL3 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | UCHL3 antibody was raised against synthetic 18 amino acid peptide from internal region of human UCHL3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Dog, Bovine, Elephant, Panda, Horse (100%); Mouse, Rat, Rabbit, Pig (94%); Opossum (83%). |
Rabbit Polyclonal Anti-UCHL3 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | UCHL3 antibody was raised against synthetic 18 amino acid peptide from internal region of human UCHL3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Mouse, Rat, Dog, Elephant, Opossum, Turkey, Chicken, Lizard (100%); Orangutan, Monkey, Bovine, Horse, Rabbit, Pig, Salmon (94%); Pufferfish, Zebrafish, Stickleback, Water flea (89%); Xenopus (83%). |
Rabbit Polyclonal Anti-UCHL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UCHL3 antibody: synthetic peptide directed towards the C terminal of human UCHL3. Synthetic peptide located within the following region: YELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA |
Rabbit Polyclonal Anti-UCHL3 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Uchl3 antibody is: synthetic peptide directed towards the middle region of Mouse Uchl3. Synthetic peptide located within the following region: IHAIANNKDKMHFESGSTLKKFLEESVSMSPEERAKFLENYDAIRVTHET |
UCHL3 MS Standard C13 and N15-labeled recombinant protein (NP_005993)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
UCHL3 (untagged) - Homo sapiens ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3), transcript variant 1
| Vector | pCMV6 series |
| Tag | Tag Free |
Transient overexpression of UCHL3 (NM_006002) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of UCHL3 (NM_001270952) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3)
| Tag | C-His |
| Expression Host | E. coli |
Recombinant protein of human ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3)
| Tag | C-His |
| Expression Host | E. coli |
Recombinant protein of human ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3)
| Tag | C-His |
| Expression Host | E. coli |
Recombinant protein of human ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3)
| Tag | C-His |
| Expression Host | E. coli |
Transient overexpression of UCHL3 (NM_006002) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of UCHL3 (NM_006002) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of UCHL3 (NM_001270952) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- UCHL3
Families
- Protease