MARK3 (Myc-DDK-tagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MARK3 (Myc-DDK-tagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MARK3 (Myc-DDK-tagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, MARK3 (Myc-DDK tagged) - Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, MARK3 (mGFP-tagged) - Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, MARK3 (Myc-DDK tagged) - Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 5, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, MARK3 (mGFP-tagged) - Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 5, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Recombinant protein of human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
MARK3 (GFP-tagged) - Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MARK3 (Myc-DDK tagged) - Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MARK3 (mGFP-tagged) - Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 5, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MARK3 (Myc-DDK tagged) - Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 5, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 5, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MARK3 (mGFP-tagged) - Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 5, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
MARK3 (Myc-DDK-tagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of MARK3 (Myc-DDK-tagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 4
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MARK3 (Myc-DDK-tagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of MARK3 (mGFP-tagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 4
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MARK3 (mGFP-tagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
MARK3 (Myc-DDK-tagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of MARK3 (Myc-DDK-tagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MARK3 (Myc-DDK-tagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of MARK3 (mGFP-tagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MARK3 (mGFP-tagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
MARK3 (Myc-DDK-tagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of MARK3 (Myc-DDK-tagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MARK3 (Myc-DDK-tagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of MARK3 (mGFP-tagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MARK3 (mGFP-tagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
MARK3 (GFP-tagged) - Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
MARK3 (GFP-tagged) - Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
MARK3 (GFP-tagged) - Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
MARK3 (GFP-tagged) - Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 5, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 5, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
MARK3 (untagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 3
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-MARK3 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human MARK3. |
Transient overexpression lysate of MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
MARK3 (untagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 4
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
MARK3 (untagged)-Kinase deficient mutant (K85M) of Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 3
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
MARK3 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
MARK3 (untagged)-Kinase deficient mutant (K85M) of Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 3
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Purified recombinant protein of Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 5, full length, with N-terminal HIS tag, expressed in E. coli, 50ug
Tag | N-His |
Expression Host | E. coli |
Rabbit Polyclonal Anti-MARK3 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MARK3 antibody: synthetic peptide directed towards the middle region of human MARK3. Synthetic peptide located within the following region: ATYNGPPASPSLSHEATPLSQTRSRGSTNLFSKLTSKLTRSRNVSAEQKD |
Carrier-free (BSA/glycerol-free) MARK3 mouse monoclonal antibody, clone OTI2A4 (formerly 2A4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MARK3 mouse monoclonal antibody, clone OTI2G8 (formerly 2G8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |