Products

View as table Download

MARK3 (Myc-DDK-tagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

MARK3 (Myc-DDK-tagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, MARK3 (Myc-DDK tagged) - Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, MARK3 (mGFP-tagged) - Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF particles, MARK3 (Myc-DDK tagged) - Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, MARK3 (mGFP-tagged) - Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

MARK3 (GFP-tagged) - Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MARK3 (Myc-DDK tagged) - Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MARK3 (mGFP-tagged) - Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 5, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MARK3 (Myc-DDK tagged) - Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 5, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MARK3 (mGFP-tagged) - Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

MARK3 (Myc-DDK-tagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of MARK3 (Myc-DDK-tagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MARK3 (Myc-DDK-tagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of MARK3 (mGFP-tagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MARK3 (mGFP-tagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

MARK3 (Myc-DDK-tagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of MARK3 (Myc-DDK-tagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MARK3 (Myc-DDK-tagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of MARK3 (mGFP-tagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MARK3 (mGFP-tagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

MARK3 (Myc-DDK-tagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of MARK3 (Myc-DDK-tagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MARK3 (Myc-DDK-tagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of MARK3 (mGFP-tagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MARK3 (mGFP-tagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

MARK3 (GFP-tagged) - Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

MARK3 (GFP-tagged) - Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

MARK3 (GFP-tagged) - Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

MARK3 (GFP-tagged) - Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 5, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 5, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

MARK3 (untagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 3

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
SC118703 is the updated version of SC118702.

Rabbit polyclonal anti-MARK3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human MARK3.

Transient overexpression lysate of MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Lenti ORF clone of Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

MARK3 (untagged)-Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 4

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

MARK3 (untagged)-Kinase deficient mutant (K85M) of Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

MARK3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

MARK3 (untagged)-Kinase deficient mutant (K85M) of Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 3

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Purified recombinant protein of Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 5, full length, with N-terminal HIS tag, expressed in E. coli, 50ug

Tag N-His
Expression Host E. coli

Rabbit Polyclonal Anti-MARK3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MARK3 antibody: synthetic peptide directed towards the middle region of human MARK3. Synthetic peptide located within the following region: ATYNGPPASPSLSHEATPLSQTRSRGSTNLFSKLTSKLTRSRNVSAEQKD

Carrier-free (BSA/glycerol-free) MARK3 mouse monoclonal antibody, clone OTI2A4 (formerly 2A4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MARK3 mouse monoclonal antibody, clone OTI2G8 (formerly 2G8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated