Products

cDNA Clones (23)
Proteins (17)
Antibodies (3)
Jump to Filters
View as table Download
STK16 (NM_003691) Human Tagged ORF Clone
RC200566

USD 98.00

USD 470.00

In Stock

STK16 (Myc-DDK-tagged)-Human serine/threonine kinase 16 (STK16), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
STK16 (NM_001008910) Human Tagged ORF Clone
RC219087

USD 420.00

In Stock

STK16 (Myc-DDK-tagged)-Human serine/threonine kinase 16 (STK16), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
STK16 (NM_003691) Human Tagged ORF Clone Lentiviral Particle
RC200566L1V

USD 820.00

3 Weeks

Lenti ORF particles, STK16 (Myc-DDK tagged) - Human serine/threonine kinase 16 (STK16), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
STK16 (NM_003691) Human Tagged ORF Clone Lentiviral Particle
RC200566L2V

USD 820.00

6 Weeks

Lenti ORF particles, STK16 (mGFP-tagged) - Human serine/threonine kinase 16 (STK16), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
STK16 (NM_001008910) Human Tagged ORF Clone Lentiviral Particle
RC219087L1V

USD 820.00

3 Weeks

Lenti ORF particles, STK16 (Myc-DDK tagged) - Human serine/threonine kinase 16 (STK16), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
STK16 (NM_001008910) Human Tagged ORF Clone Lentiviral Particle
RC219087L2V

USD 820.00

6 Weeks

Lenti ORF particles, STK16 (mGFP-tagged) - Human serine/threonine kinase 16 (STK16), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
STK16 (NM_003691) Human Tagged ORF Clone
RG200566

USD 460.00

In Stock

STK16 (GFP-tagged) - Human serine/threonine kinase 16 (STK16), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
STK16 (NM_001008910) Human Tagged ORF Clone
RG219087

USD 460.00

In Stock

STK16 (GFP-tagged) - Human serine/threonine kinase 16 (STK16), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
STK16 (NM_003691) Human Tagged ORF Clone
RC200566L3

USD 620.00

3 Weeks

Lenti ORF clone of Human serine/threonine kinase 16 (STK16), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
STK16 (NM_003691) Human Tagged ORF Clone Lentiviral Particle
RC200566L3V

USD 820.00

5 Weeks

Lenti ORF particles, STK16 (Myc-DDK tagged) - Human serine/threonine kinase 16 (STK16), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
STK16 (NM_003691) Human Tagged ORF Clone
RC200566L4

USD 620.00

3 Weeks

Lenti ORF clone of Human serine/threonine kinase 16 (STK16), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
STK16 (NM_003691) Human Tagged ORF Clone Lentiviral Particle
RC200566L4V

USD 820.00

7 Weeks

Lenti ORF particles, STK16 (mGFP-tagged) - Human serine/threonine kinase 16 (STK16), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
STK16 (NM_001008910) Human Tagged ORF Clone
RC219087L3

USD 620.00

3 Weeks

Lenti ORF clone of Human serine/threonine kinase 16 (STK16), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
STK16 (NM_001008910) Human Tagged ORF Clone Lentiviral Particle
RC219087L3V

USD 820.00

5 Weeks

Lenti ORF particles, STK16 (Myc-DDK tagged) - Human serine/threonine kinase 16 (STK16), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
STK16 (NM_001008910) Human Tagged ORF Clone
RC219087L4

USD 620.00

3 Weeks

Lenti ORF clone of Human serine/threonine kinase 16 (STK16), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
STK16 (NM_001008910) Human Tagged ORF Clone Lentiviral Particle
RC219087L4V

USD 820.00

7 Weeks

Lenti ORF particles, STK16 (mGFP-tagged) - Human serine/threonine kinase 16 (STK16), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
STK16 (NM_003691) Human Untagged Clone
SC319372

USD 660.00

In Stock

STK16 (untagged)-Human serine/threonine kinase 16 (STK16), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
STK16 (NM_003691) Human Tagged ORF Clone
RC200566L1

USD 768.00

In Stock

Lenti ORF clone of Human serine/threonine kinase 16 (STK16), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
STK16 (NM_001008910) Human Tagged ORF Clone
RC219087L1

USD 768.00

In Stock

Lenti ORF clone of Human serine/threonine kinase 16 (STK16), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
STK16 Rabbit Polyclonal Antibody
TA346579

USD 475.00

5 Days

Rabbit Polyclonal Anti-STK16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STK16 antibody: synthetic peptide directed towards the middle region of human STK16. Synthetic peptide located within the following region: TDVWSLGCVLYAMMFGEGPYDMVFQKGDSVALAVQNQLSIPQSPRHSSAL
STK16 (NM_001008910) Human Untagged Clone
SC301388

USD 660.00

3 Weeks

STK16 (untagged)-Human serine/threonine kinase 16 (STK16), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
STK16 Mouse Monoclonal Antibody [Clone ID: M2]
AM20962PU-N

USD 480.00

2 Weeks

STK16 mouse monoclonal antibody, clone M2, Purified

Applications ELISA, IHC, RNAi, WB
Reactivities Human
STK16 (NM_003691) Human Tagged ORF Clone
RC200566L2

USD 620.00

3 Weeks

Lenti ORF clone of Human serine/threonine kinase 16 (STK16), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
STK16 (NM_001008910) Human Tagged ORF Clone
RC219087L2

USD 620.00

3 Weeks

Lenti ORF clone of Human serine/threonine kinase 16 (STK16), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
STK16 (NM_003691) Human Untagged Clone
SC323397

USD 660.00

In Stock

STK16 (untagged)-Kinase deficient mutant (K49M) of Human serine/threonine kinase 16 (STK16), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
STK16 (NM_001008910) Human Over-expression Lysate
LY422898

USD 396.00

5 Days

Transient overexpression lysate of serine/threonine kinase 16 (STK16), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
STK16 (1-305, His-tag) Human Protein
AR50391PU-N

USD 845.00

2 Weeks

STK16 (1-305, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
STK16 (1-305, His-tag) Human Protein
AR50391PU-S

USD 330.00

2 Weeks

STK16 (1-305, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
STK16 (NM_003691) Human Over-expression Lysate
LC418496

USD 121.00

2 Weeks

STK16 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
STK16 (NM_001008910) Human Over-expression Lysate
LC422898

USD 121.00

2 Weeks

STK16 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
STK16 (NM_003691) Human Over-expression Lysate
LC429162

USD 121.00

2 Weeks

STK16 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
STK16 (NM_003691) Human Over-expression Lysate
LY418496

USD 396.00

5 Days

Transient overexpression lysate of serine/threonine kinase 16 (STK16), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY418496 is the same product as LY429162.
STK16 (NM_003691) Human Over-expression Lysate
LY429162

USD 396.00

5 Days

Transient overexpression lysate of serine/threonine kinase 16 (STK16), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
STK16 (NM_003691) Human Mass Spec Standard
PH300566

USD 2,055.00

3 Weeks

STK16 MS Standard C13 and N15-labeled recombinant protein (NP_003682)

Tag C-Myc/DDK
Expression Host HEK293
STK16 (NM_001008910) Human Mass Spec Standard
PH319087

USD 2,055.00

3 Weeks

STK16 MS Standard C13 and N15-labeled recombinant protein (NP_001008910)

Tag C-Myc/DDK
Expression Host HEK293
STK16 Rabbit Polyclonal Antibody
TA350459

USD 345.00

In Stock

Rabbit Polyclonal Anti-STK16 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human STK16
STK16 (NM_003691) ICC Control Block
TB400566

USD 1,120.00

4 Weeks

Transient overexpression of STK16 (NM_003691) in HEK293T cells paraffin embedded controls for ICC/IHC staining

STK16 (NM_001008910) ICC Control Block
TB419087

USD 1,070.00

4 Weeks

Transient overexpression of STK16 (NM_001008910) in HEK293T cells paraffin embedded controls for ICC/IHC staining

STK16 Cytosection
TS400566

USD 225.00

4 Weeks

Transient overexpression of STK16 (NM_003691) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

STK16 ICC Control Sections
TS400566P5

USD 889.00

4 Weeks

Transient overexpression of STK16 (NM_003691) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

STK16 Cytosection
TS419087

USD 225.00

4 Weeks

Transient overexpression of STK16 (NM_001008910) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

STK16 Cytosection
TS419087P5

USD 889.00

4 Weeks

Transient overexpression of STK16 (NM_001008910) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack