AHSG (Myc-DDK-tagged)-Human alpha-2-HS-glycoprotein (AHSG)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AHSG (Myc-DDK-tagged)-Human alpha-2-HS-glycoprotein (AHSG)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human alpha-2-HS-glycoprotein (AHSG)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
3 Weeks
Lenti ORF particles, AHSG (Myc-DDK tagged) - Human alpha-2-HS-glycoprotein (AHSG), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, AHSG (mGFP-tagged) - Human alpha-2-HS-glycoprotein (AHSG), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
AHSG (GFP-tagged) - Human alpha-2-HS-glycoprotein (AHSG)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human alpha-2-HS-glycoprotein (AHSG), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Purified recombinant protein of Human alpha-2-HS-glycoprotein (AHSG).
Tag | Tag Free |
Expression Host | HEK293 |
USD 820.00
5 Weeks
Lenti ORF particles, AHSG (Myc-DDK tagged) - Human alpha-2-HS-glycoprotein (AHSG), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, AHSG (mGFP-tagged) - Human alpha-2-HS-glycoprotein (AHSG), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
AHSG (untagged)-Human alpha-2-HS-glycoprotein (AHSG)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human alpha-2-HS-glycoprotein (AHSG), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Fetuin A (AHSG) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 254-284 amino acids from the C-terminal region of human AHSG |
Rabbit anti-AHSG Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human AHSG |
AHSG HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Transient overexpression lysate of alpha-2-HS-glycoprotein (AHSG)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human alpha-2-HS-glycoprotein (AHSG), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Goat Polyclonal Anti-AHSG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | internal region of NP_001613.2 (QPEGANEAVPTP) |
Alpha-2-HS-glycoprotein / AHSG human protein, 1 mg
Protein Source | Plasma |
AHSG MS Standard C13 and N15-labeled recombinant protein (NP_001613)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Goat polyclonal anti-Fetuin antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This purified antibody was prepared from rabbit serum after repeated immunizations with a recombinant human fetuin (a2-HS glycoprotein) processed to remove a 40 amino acid residue bridging peptide resulting in the mature form of the protein. |
Rabbit Polyclonal Anti-AHSG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AHSG antibody: synthetic peptide directed towards the N terminal of human AHSG. Synthetic peptide located within the following region: AQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTL |
Alpha-2-HS-glycoprotein / AHSG (19-367, His-tag) human recombinant protein, 0.25 mg
Tag | His-tag |
Expression Host | E. coli |
Alpha-2-HS-glycoprotein / AHSG (19-367, His-tag) human recombinant protein, 50 µg
Tag | His-tag |
Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) AHSG mouse monoclonal antibody, clone OTI2H2 (formerly 2H2)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Alpha-2-HS-glycoprotein / AHSG human protein, 0.1 mg
Protein Source | Plasma |
Rabbit Polyclonal Anti-AHSG Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human AHSG |
AHSG (alpha-2-HS-glycoprotein) mouse monoclonal antibody, clone OTI2H2 (formerly 2H2)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
AHSG (alpha-2-HS-glycoprotein) mouse monoclonal antibody, clone OTI2H2 (formerly 2H2), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
AHSG (alpha-2-HS-glycoprotein) mouse monoclonal antibody, clone OTI2H2 (formerly 2H2), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
AHSG (alpha-2-HS-glycoprotein) mouse monoclonal antibody, clone OTI2H2 (formerly 2H2)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Transient overexpression of AHSG (NM_001622) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human alpha-2-HS-glycoprotein (AHSG)
Tag | C-His |
Expression Host | HEK293 |
Recombinant protein of human alpha-2-HS-glycoprotein (AHSG)
Tag | C-His |
Expression Host | HEK293 |
Recombinant protein of human alpha-2-HS-glycoprotein (AHSG)
Tag | C-His |
Expression Host | HEK293 |
Recombinant protein of human alpha-2-HS-glycoprotein (AHSG)
Tag | C-His |
Expression Host | HEK293 |
Transient overexpression of AHSG (NM_001622) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of AHSG (NM_001622) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack