Products

Proteins (16)
Antibodies (11)
cDNA Clones (10)
Jump to Filters
View as table Download
Fetuin A (AHSG) (NM_001622) Human Tagged ORF Clone
RG208344

USD 460.00

In Stock

AHSG (GFP-tagged) - Human alpha-2-HS-glycoprotein (AHSG)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Fetuin A (AHSG) (NM_001622) Human Tagged ORF Clone
RC208344L4

USD 620.00

In Stock

Lenti ORF clone of Human alpha-2-HS-glycoprotein (AHSG), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Fetuin A (AHSG) (NM_001622) Human Recombinant Protein
TP723089

USD 240.00

2 Weeks

Purified recombinant protein of Human alpha-2-HS-glycoprotein (AHSG).

Tag Tag Free
Expression Host HEK293
Fetuin A (AHSG) (NM_001622) Human Untagged Clone
SC319889

USD 310.00

In Stock

AHSG (untagged)-Human alpha-2-HS-glycoprotein (AHSG)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Fetuin A (AHSG) (C-term) Rabbit Polyclonal Antibody
AP50120PU-N

USD 450.00

2 Weeks

Fetuin A (AHSG) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 254-284 amino acids from the C-terminal region of human AHSG
Fetuin A (AHSG) Rabbit Polyclonal Antibody
TA327122

USD 275.00

3 Weeks

Rabbit anti-AHSG Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human AHSG
Fetuin A (AHSG) (NM_001622) Human Over-expression Lysate
LC400610

USD 121.00

In Stock

AHSG HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Fetuin A (AHSG) (NM_001622) Human Over-expression Lysate
LY400610

USD 396.00

In Stock

Transient overexpression lysate of alpha-2-HS-glycoprotein (AHSG)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Fetuin A (AHSG) (NM_001622) Human Tagged ORF Clone
RC208344L2

USD 620.00

3 Weeks

Lenti ORF clone of Human alpha-2-HS-glycoprotein (AHSG), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Fetuin A (AHSG) Goat Polyclonal Antibody
TA321029

USD 375.00

5 Days

Goat Polyclonal Anti-AHSG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen internal region of NP_001613.2 (QPEGANEAVPTP)
Alpha-2-HS-glycoprotein / AHSG Human Protein
BA1073

USD 285.00

5 Days

Alpha-2-HS-glycoprotein / AHSG human protein, 1 mg

Protein Source Plasma
Fetuin A (AHSG) (NM_001622) Human Mass Spec Standard
PH308344

USD 2,055.00

3 Weeks

AHSG MS Standard C13 and N15-labeled recombinant protein (NP_001613)

Tag C-Myc/DDK
Expression Host HEK293
Fetuin A (AHSG) Goat Polyclonal Antibody
TA319149

USD 570.00

5 Days

Goat polyclonal anti-Fetuin antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This purified antibody was prepared from rabbit serum after repeated immunizations with a recombinant human fetuin (a2-HS glycoprotein) processed to remove a 40 amino acid residue bridging peptide resulting in the mature form of the protein.
Fetuin A (AHSG) Rabbit Polyclonal Antibody
TA334286

USD 375.00

5 Days

Rabbit Polyclonal Anti-AHSG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AHSG antibody: synthetic peptide directed towards the N terminal of human AHSG. Synthetic peptide located within the following region: AQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTL
Alpha-2-HS-glycoprotein / AHSG (19-367, His-tag) Human Protein
AR50904PU-N

USD 1,105.00

2 Weeks

Alpha-2-HS-glycoprotein / AHSG (19-367, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
Alpha-2-HS-glycoprotein / AHSG (19-367, His-tag) Human Protein
AR50904PU-S

USD 415.00

2 Weeks

Alpha-2-HS-glycoprotein / AHSG (19-367, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
Fetuin A (AHSG) Mouse Monoclonal Antibody [Clone ID: OTI2H2]
CF504670

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) AHSG mouse monoclonal antibody, clone OTI2H2 (formerly 2H2)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Alpha-2-HS-glycoprotein / AHSG Human Protein
PA508X

USD 320.00

2 Weeks

Alpha-2-HS-glycoprotein / AHSG human protein, 0.1 mg

Protein Source Plasma
Fetuin A (AHSG) Rabbit Polyclonal Antibody
TA349461

USD 345.00

In Stock

Rabbit Polyclonal Anti-AHSG Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human AHSG
Fetuin A (AHSG) Mouse Monoclonal Antibody [Clone ID: OTI2H2]
TA504670

USD 379.00

In Stock

AHSG (alpha-2-HS-glycoprotein) mouse monoclonal antibody, clone OTI2H2 (formerly 2H2)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Fetuin A (AHSG) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H2]
TA504670AM

USD 420.00

4 Weeks

AHSG (alpha-2-HS-glycoprotein) mouse monoclonal antibody, clone OTI2H2 (formerly 2H2), Biotinylated

Applications FC, IHC, WB
Reactivities Human
Conjugation Biotin
Fetuin A (AHSG) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H2]
TA504670BM

USD 420.00

4 Weeks

AHSG (alpha-2-HS-glycoprotein) mouse monoclonal antibody, clone OTI2H2 (formerly 2H2), HRP conjugated

Applications FC, IHC, WB
Reactivities Human
Conjugation HRP
Fetuin A (AHSG) Mouse Monoclonal Antibody [Clone ID: OTI2H2]
TA504670S

USD 159.00

In Stock

AHSG (alpha-2-HS-glycoprotein) mouse monoclonal antibody, clone OTI2H2 (formerly 2H2)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Fetuin A (AHSG) ICC Control Block
TB408344

USD 1,070.00

4 Weeks

Transient overexpression of AHSG (NM_001622) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Fetuin A (AHSG) (NM_001622) Human Recombinant Protein
TP720359

USD 330.00

3 Weeks

Recombinant protein of human alpha-2-HS-glycoprotein (AHSG)

Tag C-His
Expression Host HEK293
Fetuin A (AHSG) (NM_001622) Human Recombinant Protein
TP720359L

USD 1,900.00

3 Weeks

Recombinant protein of human alpha-2-HS-glycoprotein (AHSG)

Tag C-His
Expression Host HEK293
Fetuin A (AHSG) (NM_001622) Human Recombinant Protein
TP720359M

USD 760.00

3 Weeks

Recombinant protein of human alpha-2-HS-glycoprotein (AHSG)

Tag C-His
Expression Host HEK293
Fetuin A (AHSG) (NM_001622) Human Recombinant Protein
TP720359XL

USD 2,800.00

3 Weeks

Recombinant protein of human alpha-2-HS-glycoprotein (AHSG)

Tag C-His
Expression Host HEK293
Fetuin A (AHSG) Cytosection
TS408344

USD 225.00

4 Weeks

Transient overexpression of AHSG (NM_001622) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Fetuin A (AHSG) Cytosection
TS408344P5

USD 889.00

4 Weeks

Transient overexpression of AHSG (NM_001622) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack