Fetuin A (AHSG) (NM_001622) Human Recombinant Protein

CAT#: TP308344

Recombinant protein of human alpha-2-HS-glycoprotein (AHSG)

Product Images

Coomassie blue staining of purified AHSG protein (Cat# TP308344). The protein was produced from HEK293T cells transfected with AHSG cDNA clone (Cat# RC208344) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208344 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKSLVLLLCLAQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWP
  QQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAE
  DVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVA
  KEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPS
  PPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAA
  AGPVVPPCPGRIRHFKV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 39.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001613
• Locus ID: 197
• UniProt ID: P02765
• Cytogenetics: 3q27.3
• Refseq Size: 1594
• Refseq ORF: 1101
• Synonyms: A2HS; AHS; APMR1; FETUA; HSGA
• Summary: The protein encoded by this gene is a negatively-charged serum glycoprotein that is synthesized by hepatocytes. The encoded protein consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several processes, including endocytosis, brain development, and the formation of bone tissue. Defects in this gene are a cause of susceptibility to leanness. [provided by RefSeq, Aug 2017]
• Protein Families: Druggable Genome, Secreted Protein