Germany
Japan
United Kingdom
China
CANT1 (Myc-DDK-tagged)-Human calcium activated nucleotidase 1 (CANT1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
CANT1 (Myc-DDK-tagged)-Human calcium activated nucleotidase 1 (CANT1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
CANT1 (Myc-DDK-tagged)-Human calcium activated nucleotidase 1 (CANT1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
CANT1 (GFP-tagged) - Human calcium activated nucleotidase 1 (CANT1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human calcium activated nucleotidase 1 (CANT1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CANT1 (Myc-DDK tagged) - Human calcium activated nucleotidase 1 (CANT1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human calcium activated nucleotidase 1 (CANT1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CANT1 (mGFP-tagged) - Human calcium activated nucleotidase 1 (CANT1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human calcium activated nucleotidase 1 (CANT1), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CANT1 (Myc-DDK tagged) - Human calcium activated nucleotidase 1 (CANT1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human calcium activated nucleotidase 1 (CANT1), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CANT1 (mGFP-tagged) - Human calcium activated nucleotidase 1 (CANT1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human calcium activated nucleotidase 1 (CANT1), transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CANT1 (Myc-DDK tagged) - Human calcium activated nucleotidase 1 (CANT1), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human calcium activated nucleotidase 1 (CANT1), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CANT1 (mGFP-tagged) - Human calcium activated nucleotidase 1 (CANT1), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CANT1 (GFP-tagged) - Human calcium activated nucleotidase 1 (CANT1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CANT1 (GFP-tagged) - Human calcium activated nucleotidase 1 (CANT1), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CANT1 (untagged)-Human calcium activated nucleotidase 1 (CANT1), transcript variant 1
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
CANT1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CANT1 (untagged)-Human calcium activated nucleotidase 1 (CANT1), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Purified recombinant protein of Human calcium activated nucleotidase 1 (CANT1), transcript variant 1,Arg63-Ile401, with N-terminal His tag, expressed in E. coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Purified recombinant protein of Human calcium activated nucleotidase 1 (CANT1), transcript variant 1,Arg63-end, with N-terminal His tag, expressed in E. coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
CANT1 (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of Human CANT1/SHAPY. |
Transient overexpression lysate of calcium activated nucleotidase 1 (CANT1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal Anti-CANT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CANT1 antibody: synthetic peptide directed towards the middle region of human CANT1. Synthetic peptide located within the following region: VAVEWDKDHGVLESHLAEKGRGMELSDLIVFNGKLYSVDDRTGVVYQIEG |
Rabbit Polyclonal Anti-CANT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CANT1 antibody: synthetic peptide directed towards the middle region of human CANT1. Synthetic peptide located within the following region: SPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASY |
CANT1 / SHAPY (63-401, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
CANT1 / SHAPY (63-401, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
CANT1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CANT1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of calcium activated nucleotidase 1 (CANT1), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Transient overexpression lysate of calcium activated nucleotidase 1 (CANT1), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
CANT1 (untagged)-Human calcium activated nucleotidase 1 (CANT1) transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
CANT1 (untagged)-Human calcium activated nucleotidase 1 (CANT1) transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
USD 420.00
4 Weeks
Transient overexpression of CANT1 (NM_138793) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CANT1 (NM_001159772) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CANT1 (NM_001159773) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human calcium activated nucleotidase 1 (CANT1), transcript variant 3, full length, with N-GST and C-His tag, expressed in E.coli, 50ug
| Tag | N-GST and C-HIS |
| Expression Host | E. coli |
Purified recombinant protein of Human calcium activated nucleotidase 1 (CANT1), transcript variant 2, full length, with N-GST and C-His tag, expressed in E.coli, 50ug
| Tag | N-GST and C-HIS |
| Expression Host | E. coli |
Transient overexpression of CANT1 (NM_138793) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CANT1 (NM_138793) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CANT1 (NM_001159772) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CANT1 (NM_001159772) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CANT1 (NM_001159773) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Active filters
Target Symbol
- CANT1
Families
- Secreted Protein