CANT1 (Myc-DDK-tagged)-Human calcium activated nucleotidase 1 (CANT1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CANT1 (Myc-DDK-tagged)-Human calcium activated nucleotidase 1 (CANT1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CANT1 (Myc-DDK-tagged)-Human calcium activated nucleotidase 1 (CANT1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CANT1 (Myc-DDK-tagged)-Human calcium activated nucleotidase 1 (CANT1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CANT1 (GFP-tagged) - Human calcium activated nucleotidase 1 (CANT1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Cant1 (Myc-DDK-tagged) - Mouse calcium activated nucleotidase 1 (Cant1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Cant1 (myc-DDK-tagged) - Mouse calcium activated nucleotidase 1 (Cant1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Cant1 (myc-DDK-tagged) - Mouse calcium activated nucleotidase 1 (Cant1), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CANT1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Cant1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Cant1 (GFP-tagged) - Mouse calcium activated nucleotidase 1 (Cant1), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Cant1 (Myc-DDK-tagged) - Mouse calcium activated nucleotidase 1 (Cant1), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Cant1 (Myc-DDK-tagged) - Mouse calcium activated nucleotidase 1 (Cant1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Cant1 (mGFP-tagged) - Mouse calcium activated nucleotidase 1 (Cant1), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Cant1 (GFP-tagged) - Mouse calcium activated nucleotidase 1 (Cant1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Cant1 (myc-DDK-tagged) - Mouse calcium activated nucleotidase 1 (Cant1), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human calcium activated nucleotidase 1 (CANT1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CANT1 (Myc-DDK tagged) - Human calcium activated nucleotidase 1 (CANT1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human calcium activated nucleotidase 1 (CANT1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CANT1 (mGFP-tagged) - Human calcium activated nucleotidase 1 (CANT1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human calcium activated nucleotidase 1 (CANT1), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CANT1 (Myc-DDK tagged) - Human calcium activated nucleotidase 1 (CANT1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human calcium activated nucleotidase 1 (CANT1), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CANT1 (mGFP-tagged) - Human calcium activated nucleotidase 1 (CANT1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human calcium activated nucleotidase 1 (CANT1), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CANT1 (Myc-DDK tagged) - Human calcium activated nucleotidase 1 (CANT1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human calcium activated nucleotidase 1 (CANT1), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CANT1 (mGFP-tagged) - Human calcium activated nucleotidase 1 (CANT1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CANT1 (GFP-tagged) - Human calcium activated nucleotidase 1 (CANT1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CANT1 (GFP-tagged) - Human calcium activated nucleotidase 1 (CANT1), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Cant1 (Myc-DDK-tagged ORF) - Rat calcium activated nucleotidase 1 (Cant1), (10 ug)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Cant1 (Myc-DDK-tagged ORF) - Rat calcium activated nucleotidase 1 (Cant1), (10 ug)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Cant1 (Myc-DDK-tagged ORF) - Rat calcium activated nucleotidase 1 (Cant1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Cant1 (mGFP-tagged ORF) - Rat calcium activated nucleotidase 1 (Cant1), (10 ug)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Cant1 (GFP-tagged ORF) - Rat calcium activated nucleotidase 1 (Cant1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CANT1 (untagged)-Human calcium activated nucleotidase 1 (CANT1), transcript variant 1
Vector | pCMV6-XL6 |
Tag | Tag Free |
Mammalian Cell Selection | None |
CANT1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Cant1 (untagged) - Mouse calcium activated nucleotidase 1 (Cant1), transcript variant 1, (10ug)
Vector | PCMV6-Kan/Neo |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
CANT1 (untagged)-Human calcium activated nucleotidase 1 (CANT1), transcript variant 1
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Purified recombinant protein of Human calcium activated nucleotidase 1 (CANT1), transcript variant 1,Arg63-Ile401, with N-terminal His tag, expressed in E. coli, 50ug
Tag | N-His |
Expression Host | E. coli |
Purified recombinant protein of Human calcium activated nucleotidase 1 (CANT1), transcript variant 1,Arg63-end, with N-terminal His tag, expressed in E. coli, 50ug
Tag | N-His |
Expression Host | E. coli |
CANT1 (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of Human CANT1/SHAPY. |
Transient overexpression lysate of calcium activated nucleotidase 1 (CANT1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-CANT1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CANT1 antibody: synthetic peptide directed towards the middle region of human CANT1. Synthetic peptide located within the following region: VAVEWDKDHGVLESHLAEKGRGMELSDLIVFNGKLYSVDDRTGVVYQIEG |
Rabbit Polyclonal Anti-CANT1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CANT1 antibody: synthetic peptide directed towards the middle region of human CANT1. Synthetic peptide located within the following region: SPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASY |
CANT1 / SHAPY (63-401, His-tag) human recombinant protein, 0.25 mg
Tag | His-tag |
Expression Host | E. coli |
CANT1 / SHAPY (63-401, His-tag) human recombinant protein, 50 µg
Tag | His-tag |
Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) CANT1 mouse monoclonal antibody, clone OTI7F8 (formerly 7F8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CANT1 CRISPRa kit - CRISPR gene activation of human calcium activated nucleotidase 1
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Cant1 CRISPRa kit - CRISPR gene activation of mouse calcium activated nucleotidase 1
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene CANT1
Application | Plasmid of exact quantity for transcript copy number calculation |