Products

View as table Download

CANT1 (Myc-DDK-tagged)-Human calcium activated nucleotidase 1 (CANT1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

CANT1 (Myc-DDK-tagged)-Human calcium activated nucleotidase 1 (CANT1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

CANT1 (Myc-DDK-tagged)-Human calcium activated nucleotidase 1 (CANT1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

CANT1 (GFP-tagged) - Human calcium activated nucleotidase 1 (CANT1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Cant1 (Myc-DDK-tagged) - Mouse calcium activated nucleotidase 1 (Cant1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Cant1 (myc-DDK-tagged) - Mouse calcium activated nucleotidase 1 (Cant1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Cant1 (myc-DDK-tagged) - Mouse calcium activated nucleotidase 1 (Cant1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

CANT1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN402348 is the updated version of KN202348.

Cant1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN502497 is the updated version of KN302497.

Cant1 (GFP-tagged) - Mouse calcium activated nucleotidase 1 (Cant1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Cant1 (Myc-DDK-tagged) - Mouse calcium activated nucleotidase 1 (Cant1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Cant1 (Myc-DDK-tagged) - Mouse calcium activated nucleotidase 1 (Cant1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Cant1 (mGFP-tagged) - Mouse calcium activated nucleotidase 1 (Cant1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Cant1 (GFP-tagged) - Mouse calcium activated nucleotidase 1 (Cant1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Cant1 (myc-DDK-tagged) - Mouse calcium activated nucleotidase 1 (Cant1), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human calcium activated nucleotidase 1 (CANT1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CANT1 (Myc-DDK tagged) - Human calcium activated nucleotidase 1 (CANT1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human calcium activated nucleotidase 1 (CANT1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CANT1 (mGFP-tagged) - Human calcium activated nucleotidase 1 (CANT1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human calcium activated nucleotidase 1 (CANT1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CANT1 (Myc-DDK tagged) - Human calcium activated nucleotidase 1 (CANT1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human calcium activated nucleotidase 1 (CANT1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CANT1 (mGFP-tagged) - Human calcium activated nucleotidase 1 (CANT1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human calcium activated nucleotidase 1 (CANT1), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CANT1 (Myc-DDK tagged) - Human calcium activated nucleotidase 1 (CANT1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human calcium activated nucleotidase 1 (CANT1), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CANT1 (mGFP-tagged) - Human calcium activated nucleotidase 1 (CANT1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

CANT1 (GFP-tagged) - Human calcium activated nucleotidase 1 (CANT1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

CANT1 (GFP-tagged) - Human calcium activated nucleotidase 1 (CANT1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Cant1 (Myc-DDK-tagged ORF) - Rat calcium activated nucleotidase 1 (Cant1), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Cant1 (Myc-DDK-tagged ORF) - Rat calcium activated nucleotidase 1 (Cant1), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Cant1 (Myc-DDK-tagged ORF) - Rat calcium activated nucleotidase 1 (Cant1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Cant1 (mGFP-tagged ORF) - Rat calcium activated nucleotidase 1 (Cant1), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Cant1 (GFP-tagged ORF) - Rat calcium activated nucleotidase 1 (Cant1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

CANT1 (untagged)-Human calcium activated nucleotidase 1 (CANT1), transcript variant 1

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None

CANT1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Cant1 (untagged) - Mouse calcium activated nucleotidase 1 (Cant1), transcript variant 1, (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin

CANT1 (untagged)-Human calcium activated nucleotidase 1 (CANT1), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Purified recombinant protein of Human calcium activated nucleotidase 1 (CANT1), transcript variant 1,Arg63-Ile401, with N-terminal His tag, expressed in E. coli, 50ug

Tag N-His
Expression Host E. coli

Purified recombinant protein of Human calcium activated nucleotidase 1 (CANT1), transcript variant 1,Arg63-end, with N-terminal His tag, expressed in E. coli, 50ug

Tag N-His
Expression Host E. coli

CANT1 (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of Human CANT1/SHAPY.

Rabbit Polyclonal Anti-CANT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CANT1 antibody: synthetic peptide directed towards the middle region of human CANT1. Synthetic peptide located within the following region: VAVEWDKDHGVLESHLAEKGRGMELSDLIVFNGKLYSVDDRTGVVYQIEG

Rabbit Polyclonal Anti-CANT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CANT1 antibody: synthetic peptide directed towards the middle region of human CANT1. Synthetic peptide located within the following region: SPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASY

CANT1 / SHAPY (63-401, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli

CANT1 / SHAPY (63-401, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli

Carrier-free (BSA/glycerol-free) CANT1 mouse monoclonal antibody, clone OTI7F8 (formerly 7F8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CANT1 CRISPRa kit - CRISPR gene activation of human calcium activated nucleotidase 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

Cant1 CRISPRa kit - CRISPR gene activation of mouse calcium activated nucleotidase 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

qPCR primer pairs and template standards against Homo sapiens gene CANT1

Application Plasmid of exact quantity for transcript copy number calculation