Products

cDNA Clones (44)
Proteins (21)
RNAi (12)
Antibodies (11)
Gene Expression (8)
Jump to Filters
View as table Download
CANT1 (NM_138793) Human Tagged ORF Clone
RC202348

USD 420.00

In Stock

CANT1 (Myc-DDK-tagged)-Human calcium activated nucleotidase 1 (CANT1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CANT1 (NM_001159772) Human Tagged ORF Clone
RC228878

USD 420.00

In Stock

CANT1 (Myc-DDK-tagged)-Human calcium activated nucleotidase 1 (CANT1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CANT1 (NM_001159773) Human Tagged ORF Clone
RC228879

USD 420.00

In Stock

CANT1 (Myc-DDK-tagged)-Human calcium activated nucleotidase 1 (CANT1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CANT1 (NM_138793) Human Tagged ORF Clone
RG202348

USD 460.00

In Stock

CANT1 (GFP-tagged) - Human calcium activated nucleotidase 1 (CANT1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cant1 (NM_001025617) Mouse Tagged ORF Clone
MR206327

USD 300.00

In Stock

Cant1 (Myc-DDK-tagged) - Mouse calcium activated nucleotidase 1 (Cant1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Cant1 (NM_001025618) Mouse Tagged ORF Clone
MR229723

USD 300.00

In Stock

Cant1 (myc-DDK-tagged) - Mouse calcium activated nucleotidase 1 (Cant1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Cant1 (NM_001267591) Mouse Tagged ORF Clone
MR229724

USD 300.00

In Stock

Cant1 (myc-DDK-tagged) - Mouse calcium activated nucleotidase 1 (Cant1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CANT1 Human Gene Knockout Kit (CRISPR)
KN402348

USD 1,290.00

2 Weeks

CANT1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN402348 is the updated version of KN202348.
Cant1 Mouse Gene Knockout Kit (CRISPR)
KN502497

USD 1,290.00

2 Weeks

Cant1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN502497 is the updated version of KN302497.
Cant1 (NM_001025618) Mouse Tagged ORF Clone
MG206327

USD 330.00

3 Weeks

Cant1 (GFP-tagged) - Mouse calcium activated nucleotidase 1 (Cant1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cant1 (NM_001025617) Mouse Tagged ORF Clone
MR206327L3

USD 500.00

3 Weeks

Lenti ORF clone of Cant1 (Myc-DDK-tagged) - Mouse calcium activated nucleotidase 1 (Cant1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cant1 (NM_001025617) Mouse Tagged ORF Clone Lentiviral Particle
MR206327L3V

USD 700.00

6 Weeks

Lenti ORF particles, Cant1 (Myc-DDK-tagged) - Mouse calcium activated nucleotidase 1 (Cant1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cant1 (NM_001025617) Mouse Tagged ORF Clone
MR206327L4

USD 500.00

3 Weeks

Lenti ORF clone of Cant1 (mGFP-tagged) - Mouse calcium activated nucleotidase 1 (Cant1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cant1 (NM_001025617) Mouse Tagged ORF Clone Lentiviral Particle
MR206327L4V

USD 700.00

6 Weeks

Lenti ORF particles, Cant1 (GFP-tagged) - Mouse calcium activated nucleotidase 1 (Cant1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cant1 (NM_001267592) Mouse Tagged ORF Clone
MR229926

USD 460.00

2 Weeks

Cant1 (myc-DDK-tagged) - Mouse calcium activated nucleotidase 1 (Cant1), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CANT1 (NM_138793) Human Tagged ORF Clone
RC202348L3

USD 620.00

3 Weeks

Lenti ORF clone of Human calcium activated nucleotidase 1 (CANT1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CANT1 (NM_138793) Human Tagged ORF Clone Lentiviral Particle
RC202348L3V

USD 820.00

6 Weeks

Lenti ORF particles, CANT1 (Myc-DDK tagged) - Human calcium activated nucleotidase 1 (CANT1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CANT1 (NM_138793) Human Tagged ORF Clone
RC202348L4

USD 620.00

3 Weeks

Lenti ORF clone of Human calcium activated nucleotidase 1 (CANT1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CANT1 (NM_138793) Human Tagged ORF Clone Lentiviral Particle
RC202348L4V

USD 820.00

6 Weeks

Lenti ORF particles, CANT1 (mGFP-tagged) - Human calcium activated nucleotidase 1 (CANT1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CANT1 (NM_001159772) Human Tagged ORF Clone
RC228878L3

USD 620.00

3 Weeks

Lenti ORF clone of Human calcium activated nucleotidase 1 (CANT1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CANT1 (NM_001159772) Human Tagged ORF Clone Lentiviral Particle
RC228878L3V

USD 820.00

6 Weeks

Lenti ORF particles, CANT1 (Myc-DDK tagged) - Human calcium activated nucleotidase 1 (CANT1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CANT1 (NM_001159772) Human Tagged ORF Clone
RC228878L4

USD 620.00

3 Weeks

Lenti ORF clone of Human calcium activated nucleotidase 1 (CANT1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CANT1 (NM_001159772) Human Tagged ORF Clone Lentiviral Particle
RC228878L4V

USD 820.00

6 Weeks

Lenti ORF particles, CANT1 (mGFP-tagged) - Human calcium activated nucleotidase 1 (CANT1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CANT1 (NM_001159773) Human Tagged ORF Clone
RC228879L3

USD 620.00

3 Weeks

Lenti ORF clone of Human calcium activated nucleotidase 1 (CANT1), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CANT1 (NM_001159773) Human Tagged ORF Clone Lentiviral Particle
RC228879L3V

USD 820.00

6 Weeks

Lenti ORF particles, CANT1 (Myc-DDK tagged) - Human calcium activated nucleotidase 1 (CANT1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CANT1 (NM_001159773) Human Tagged ORF Clone
RC228879L4

USD 620.00

3 Weeks

Lenti ORF clone of Human calcium activated nucleotidase 1 (CANT1), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CANT1 (NM_001159773) Human Tagged ORF Clone Lentiviral Particle
RC228879L4V

USD 820.00

6 Weeks

Lenti ORF particles, CANT1 (mGFP-tagged) - Human calcium activated nucleotidase 1 (CANT1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CANT1 (NM_001159772) Human Tagged ORF Clone
RG228878

USD 460.00

3 Weeks

CANT1 (GFP-tagged) - Human calcium activated nucleotidase 1 (CANT1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CANT1 (NM_001159773) Human Tagged ORF Clone
RG228879

USD 460.00

3 Weeks

CANT1 (GFP-tagged) - Human calcium activated nucleotidase 1 (CANT1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cant1 (NM_144754) Rat Tagged ORF Clone
RR207309

USD 420.00

4 Weeks

Cant1 (Myc-DDK-tagged ORF) - Rat calcium activated nucleotidase 1 (Cant1), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Cant1 (NM_144754) Rat Tagged ORF Clone
RR207309L3

USD 640.00

8 Weeks

Lenti ORF clone of Cant1 (Myc-DDK-tagged ORF) - Rat calcium activated nucleotidase 1 (Cant1), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cant1 (NM_144754) Rat Tagged ORF Clone Lentiviral Particle
RR207309L3V

USD 850.00

12 Weeks

Lenti ORF particles, Cant1 (Myc-DDK-tagged ORF) - Rat calcium activated nucleotidase 1 (Cant1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cant1 (NM_144754) Rat Tagged ORF Clone
RR207309L4

USD 700.00

8 Weeks

Lenti ORF clone of Cant1 (mGFP-tagged ORF) - Rat calcium activated nucleotidase 1 (Cant1), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cant1 (NM_144754) Rat Tagged ORF Clone Lentiviral Particle
RR207309L4V

USD 960.00

12 Weeks

Lenti ORF particles, Cant1 (GFP-tagged ORF) - Rat calcium activated nucleotidase 1 (Cant1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CANT1 (NM_138793) Human Untagged Clone
SC120658

USD 310.00

In Stock

CANT1 (untagged)-Human calcium activated nucleotidase 1 (CANT1), transcript variant 1

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
CANT1 (NM_138793) Human Over-expression Lysate
LC408394

USD 121.00

In Stock

CANT1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Cant1 (NM_029502) Mouse Untagged Clone
MC201456

USD 210.00

In Stock

Cant1 (untagged) - Mouse calcium activated nucleotidase 1 (Cant1), transcript variant 1, (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
CANT1 (NM_138793) Human Untagged Clone
SC322338

USD 310.00

In Stock

CANT1 (untagged)-Human calcium activated nucleotidase 1 (CANT1), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
CANT1 (NM_138793) Human Recombinant Protein
TP762074

USD 215.00

In Stock

Purified recombinant protein of Human calcium activated nucleotidase 1 (CANT1), transcript variant 1,Arg63-Ile401, with N-terminal His tag, expressed in E. coli, 50ug

Tag N-His
Expression Host E. coli
CANT1 (NM_138793) Human Recombinant Protein
TP762123

USD 215.00

In Stock

Purified recombinant protein of Human calcium activated nucleotidase 1 (CANT1), transcript variant 1,Arg63-end, with N-terminal His tag, expressed in E. coli, 50ug

Tag N-His
Expression Host E. coli
CANT1 (N-term) Rabbit Polyclonal Antibody
AP17919PU-N

USD 450.00

2 Weeks

CANT1 (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of Human CANT1/SHAPY.
CANT1 (NM_138793) Human Over-expression Lysate
LY408394

USD 396.00

5 Days

Transient overexpression lysate of calcium activated nucleotidase 1 (CANT1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CANT1 Rabbit Polyclonal Antibody
TA340307

USD 375.00

5 Days

Rabbit Polyclonal Anti-CANT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CANT1 antibody: synthetic peptide directed towards the middle region of human CANT1. Synthetic peptide located within the following region: VAVEWDKDHGVLESHLAEKGRGMELSDLIVFNGKLYSVDDRTGVVYQIEG
CANT1 Rabbit Polyclonal Antibody
TA340308

USD 375.00

5 Days

Rabbit Polyclonal Anti-CANT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CANT1 antibody: synthetic peptide directed towards the middle region of human CANT1. Synthetic peptide located within the following region: SPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASY
CANT1 / SHAPY (63-401, His-tag) Human Protein
AR50163PU-N

USD 1,105.00

2 Weeks

CANT1 / SHAPY (63-401, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
CANT1 / SHAPY (63-401, His-tag) Human Protein
AR50163PU-S

USD 415.00

2 Weeks

CANT1 / SHAPY (63-401, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
CANT1 Mouse Monoclonal Antibody [Clone ID: OTI7F8]
CF805629

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CANT1 mouse monoclonal antibody, clone OTI7F8 (formerly 7F8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Human CANT1 activation kit by CRISPRa
GA114849

USD 1,290.00

2 Weeks

CANT1 CRISPRa kit - CRISPR gene activation of human calcium activated nucleotidase 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Cant1 activation kit by CRISPRa
GA210420

USD 1,290.00

2 Weeks

Cant1 CRISPRa kit - CRISPR gene activation of mouse calcium activated nucleotidase 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
CANT1 Human qPCR Template Standard (NM_138793)
HK201622

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene CANT1

Application Plasmid of exact quantity for transcript copy number calculation