Products

View as table Download

CCL13 (Myc-DDK-tagged)-Human chemokine (C-C motif) ligand 13 (CCL13)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

CCL13 (GFP-tagged) - Human chemokine (C-C motif) ligand 13 (CCL13)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human chemokine (C-C motif) ligand 13 (CCL13), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human chemokine (C-C motif) ligand 13 (CCL13), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Purified recombinant protein of Human chemokine (C-C motif) ligand 13 (CCL13 / MCP-4)

Tag Tag Free
Expression Host E. coli

Purified recombinant protein of Human chemokine (C-C motif) ligand 13 (CCL13).

Tag Tag Free
Expression Host E. coli

CCL13 (untagged)-Human chemokine (C-C motif) ligand 13 (CCL13)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

CCL13 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

CCL13 (untagged)-Human chemokine (C-C motif) ligand 13 (cDNA clone MGC:17134 IMAGE:4184250), complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-CCL13 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCL13 antibody: synthetic peptide directed towards the middle region of human CCL13. Synthetic peptide located within the following region: KSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT

MCP-4 / CCL13 (24-98, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli

MCP-4 / CCL13 (24-98, His-tag) human recombinant protein, 10 µg

Tag His-tag
Expression Host E. coli

Anti-CCL13 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 86-98 amino acids of Human C-C motif chemokine 13

Transient overexpression of CCL13 (NM_005408) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of CCL13 (NM_005408) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of CCL13 (NM_005408) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack