Products

Antibodies (38)
cDNA Clones (20)
Proteins (15)
Jump to Filters
View as table Download
Laminin 5 (LAMB3) (NM_000228) Human Tagged ORF Clone
RC215510

USD 1,230.00

In Stock

LAMB3 (Myc-DDK-tagged)-Human laminin, beta 3 (LAMB3), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Laminin 5 (LAMB3) (NM_001127641) Human Tagged ORF Clone
RC226349

USD 1,230.00

In Stock

LAMB3 (Myc-DDK-tagged)-Human laminin, beta 3 (LAMB3), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Laminin 5 (LAMB3) (NM_000228) Human Tagged ORF Clone
RG215510

USD 1,350.00

In Stock

LAMB3 (GFP-tagged) - Human laminin, beta 3 (LAMB3), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Laminin 5 (LAMB3) (NM_001017402) Human Tagged ORF Clone
RC210050

USD 1,230.00

In Stock

LAMB3 (Myc-DDK-tagged)-Human laminin, beta 3 (LAMB3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Laminin 5 (LAMB3) (NM_001017402) Human Tagged ORF Clone
RC210050L3

USD 1,430.00

3 Weeks

Lenti ORF clone of Human laminin, beta 3 (LAMB3), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Laminin 5 (LAMB3) (NM_001017402) Human Tagged ORF Clone Lentiviral Particle
RC210050L3V

USD 1,630.00

6 Weeks

Lenti ORF particles, LAMB3 (Myc-DDK tagged) - Human laminin, beta 3 (LAMB3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Laminin 5 (LAMB3) (NM_001017402) Human Tagged ORF Clone
RC210050L4

USD 1,430.00

3 Weeks

Lenti ORF clone of Human laminin, beta 3 (LAMB3), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Laminin 5 (LAMB3) (NM_000228) Human Tagged ORF Clone
RC215510L3

USD 1,430.00

3 Weeks

Lenti ORF clone of Human laminin, beta 3 (LAMB3), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Laminin 5 (LAMB3) (NM_000228) Human Tagged ORF Clone Lentiviral Particle
RC215510L3V

USD 1,630.00

6 Weeks

Lenti ORF particles, LAMB3 (Myc-DDK tagged) - Human laminin, beta 3 (LAMB3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Laminin 5 (LAMB3) (NM_001127641) Human Tagged ORF Clone
RC226349L3

USD 1,430.00

3 Weeks

Lenti-ORF clone of LAMB3 (Myc-DDK-tagged)-Human laminin, beta 3 (LAMB3), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Laminin 5 (LAMB3) (NM_001127641) Human Tagged ORF Clone Lentiviral Particle
RC226349L3V

USD 1,630.00

6 Weeks

Lenti ORF particles, LAMB3 (Myc-DDK-tagged)-Human laminin, beta 3 (LAMB3), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Laminin 5 (LAMB3) (NM_001127641) Human Tagged ORF Clone
RC226349L4

USD 1,430.00

3 Weeks

Lenti-ORF clone of LAMB3 (mGFP-tagged)-Human laminin, beta 3 (LAMB3), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Laminin 5 (LAMB3) (NM_001017402) Human Tagged ORF Clone
RG210050

USD 1,350.00

3 Weeks

LAMB3 (GFP-tagged) - Human laminin, beta 3 (LAMB3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Laminin 5 (LAMB3) (NM_001127641) Human Tagged ORF Clone
RG226349

USD 1,350.00

3 Weeks

LAMB3 (GFP-tagged) - Human laminin, beta 3 (LAMB3), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Laminin 5 (LAMB3) Rabbit Polyclonal Antibody
TA308917

USD 415.00

2 Weeks

Rabbit Polyclonal antibody to Laminin beta 3 (laminin, beta 3)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 644 and 960 of Laminin beta 3 (Uniprot ID#Q13751)
Laminin 5 (LAMB3) (NM_001017402) Human Untagged Clone
SC302037

USD 1,100.00

In Stock

LAMB3 (untagged)-Human laminin, beta 3 (LAMB3), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Laminin 5 (LAMB3) Rabbit Polyclonal Antibody
TA313358

USD 345.00

In Stock

Rabbit polyclonal anti-LAMB3 antibody

Applications IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human LAMB3.
Laminin 5 (LAMB3) Rabbit Polyclonal Antibody
TA346167

USD 475.00

5 Days

Rabbit Polyclonal Anti-LAMB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LAMB3 antibody: synthetic peptide directed towards the middle region of human LAMB3. Synthetic peptide located within the following region: ERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKD
Laminin 5 (LAMB3) (NM_000228) Human Over-expression Lysate
LC424856

USD 187.00

In Stock

LAMB3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Laminin 5 (LAMB3) (NM_001127641) Human Over-expression Lysate
LC426828

USD 187.00

In Stock

LAMB3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Laminin 5 (LAMB3) (NM_000228) Human Over-expression Lysate
LY424856

USD 605.00

In Stock

Transient overexpression lysate of laminin, beta 3 (LAMB3), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Laminin 5 (LAMB3) (NM_000228) Human Untagged Clone
SC300029

USD 1,100.00

2 Weeks

LAMB3 (untagged)-Human laminin, beta 3 (LAMB3), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Laminin 5 (LAMB3) Mouse Monoclonal Antibody [Clone ID: OTI3A2]
CF804424

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) LAMB3 mouse monoclonal antibody, clone OTI3A2 (formerly 3A2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Laminin 5 (LAMB3) Mouse Monoclonal Antibody [Clone ID: OTI1E7]
CF804425

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) Purified LAMB3 mouse monoclonal antibody, clone OTI1E7 (formerly 1E7)

Applications WB
Reactivities Human
Conjugation Unconjugated
Laminin 5 (LAMB3) Mouse Monoclonal Antibody [Clone ID: OTI8H5]
CF804756

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) LAMB3 mouse monoclonal antibody, clone OTI8H5 (formerly 8H5)

Applications WB
Reactivities Human
Conjugation Unconjugated
Laminin 5 (LAMB3) Mouse Monoclonal Antibody [Clone ID: OTI9G3]
CF805986

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) LAMB3 mouse monoclonal antibody, clone OTI9G3 (formerly 9G3)

Applications WB
Reactivities Human
Conjugation Unconjugated
Laminin 5 (LAMB3) Mouse Monoclonal Antibody [Clone ID: OTI1H10]
CF806059

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) LAMB3 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Laminin 5 (LAMB3) Mouse Monoclonal Antibody [Clone ID: OTI1D3]
CF806062

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) LAMB3 mouse monoclonal antibody, clone OTI1D3 (formerly 1D3)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Laminin 5 (LAMB3) (NM_001127641) Human Over-expression Lysate
LY426828

USD 605.00

5 Days

Transient overexpression lysate of laminin, beta 3 (LAMB3), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Laminin 5 (LAMB3) (NM_001127641) Human Untagged Clone
SC323262

USD 1,100.00

6 Weeks

LAMB3 (untagged)-Human laminin, beta 3 (LAMB3), transcript variant 3

Vector pCMV6 series
Tag Tag Free
Laminin 5 (LAMB3) Rabbit Polyclonal Antibody
TA350129

USD 345.00

In Stock

Rabbit Polyclonal Anti-LAMB3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human LAMB3
Laminin 5 (LAMB3) Mouse Monoclonal Antibody [Clone ID: OTI3A2]
TA804424

USD 379.00

In Stock

LAMB3 mouse monoclonal antibody, clone OTI3A2 (formerly 3A2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Laminin 5 (LAMB3) Mouse Monoclonal Antibody [Clone ID: OTI3A2]
TA804424S

USD 159.00

2 Days

LAMB3 mouse monoclonal antibody, clone OTI3A2 (formerly 3A2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Laminin 5 (LAMB3) Mouse Monoclonal Antibody [Clone ID: OTI1E7]
TA804425

USD 379.00

In Stock

Purified LAMB3 mouse monoclonal antibody, clone OTI1E7 (formerly 1E7)

Applications WB
Reactivities Human
Conjugation Unconjugated
Laminin 5 (LAMB3) Mouse Monoclonal Antibody [Clone ID: OTI1E7]
TA804425S

USD 159.00

2 Days

Purified LAMB3 mouse monoclonal antibody, clone OTI1E7 (formerly 1E7)

Applications WB
Reactivities Human
Conjugation Unconjugated
Laminin 5 (LAMB3) Mouse Monoclonal Antibody [Clone ID: OTI8H5]
TA804756

USD 379.00

In Stock

LAMB3 mouse monoclonal antibody, clone OTI8H5 (formerly 8H5)

Applications WB
Reactivities Human
Conjugation Unconjugated
Laminin 5 (LAMB3) Mouse Monoclonal Antibody [Clone ID: OTI8H5]
TA804756S

USD 159.00

2 Days

LAMB3 mouse monoclonal antibody, clone OTI8H5 (formerly 8H5)

Applications WB
Reactivities Human
Conjugation Unconjugated