Products

Antibodies (39)
cDNA Clones (34)
Proteins (15)
RNAi (8)
Gene Expression (6)
Jump to Filters
View as table Download
Laminin 5 (LAMB3) (NM_000228) Human Tagged ORF Clone
RC215510

USD 1,230.00

In Stock

LAMB3 (Myc-DDK-tagged)-Human laminin, beta 3 (LAMB3), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Laminin 5 (LAMB3) (NM_001127641) Human Tagged ORF Clone
RC226349

USD 1,230.00

In Stock

LAMB3 (Myc-DDK-tagged)-Human laminin, beta 3 (LAMB3), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Laminin 5 (LAMB3) (NM_000228) Human Tagged ORF Clone
RG215510

USD 1,350.00

In Stock

LAMB3 (GFP-tagged) - Human laminin, beta 3 (LAMB3), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Lamb3 (NM_008484) Mouse Tagged ORF Clone
MR211741

USD 1,010.00

In Stock

Lamb3 (Myc-DDK-tagged) - Mouse laminin, beta 3 (Lamb3)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Lamb3 (NM_001277928) Mouse Tagged ORF Clone
MR231645

USD 1,010.00

In Stock

Lamb3 (myc-DDK-tagged) - Mouse laminin, beta 3 (Lamb3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Laminin 5 (LAMB3) (NM_001017402) Human Tagged ORF Clone
RC210050

USD 1,230.00

In Stock

LAMB3 (Myc-DDK-tagged)-Human laminin, beta 3 (LAMB3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Lamb3 Mouse Gene Knockout Kit (CRISPR)
KN509113

USD 1,290.00

2 Weeks

Lamb3 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN509113 is the updated version of KN309113.
Lamb3 (NM_008484) Mouse Tagged ORF Clone
MG211741

USD 1,110.00

3 Weeks

Lamb3 (GFP-tagged) - Mouse laminin, beta 3 (Lamb3)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Lamb3 (NM_008484) Mouse Tagged ORF Clone
MR211741L3

USD 1,210.00

3 Weeks

Lenti ORF clone of Lamb3 (Myc-DDK-tagged) - Mouse laminin, beta 3 (Lamb3)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Lamb3 (NM_008484) Mouse Tagged ORF Clone
MR211741L4

USD 1,210.00

3 Weeks

Lenti ORF clone of Lamb3 (mGFP-tagged) - Mouse laminin, beta 3 (Lamb3)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Laminin 5 (LAMB3) (NM_001017402) Human Tagged ORF Clone
RC210050L3

USD 1,430.00

3 Weeks

Lenti ORF clone of Human laminin, beta 3 (LAMB3), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Laminin 5 (LAMB3) (NM_001017402) Human Tagged ORF Clone Lentiviral Particle
RC210050L3V

USD 1,630.00

6 Weeks

Lenti ORF particles, LAMB3 (Myc-DDK tagged) - Human laminin, beta 3 (LAMB3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Laminin 5 (LAMB3) (NM_001017402) Human Tagged ORF Clone
RC210050L4

USD 1,430.00

3 Weeks

Lenti ORF clone of Human laminin, beta 3 (LAMB3), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Laminin 5 (LAMB3) (NM_000228) Human Tagged ORF Clone
RC215510L3

USD 1,430.00

3 Weeks

Lenti ORF clone of Human laminin, beta 3 (LAMB3), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Laminin 5 (LAMB3) (NM_000228) Human Tagged ORF Clone Lentiviral Particle
RC215510L3V

USD 1,630.00

6 Weeks

Lenti ORF particles, LAMB3 (Myc-DDK tagged) - Human laminin, beta 3 (LAMB3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Laminin 5 (LAMB3) (NM_001127641) Human Tagged ORF Clone
RC226349L3

USD 1,430.00

3 Weeks

Lenti-ORF clone of LAMB3 (Myc-DDK-tagged)-Human laminin, beta 3 (LAMB3), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Laminin 5 (LAMB3) (NM_001127641) Human Tagged ORF Clone Lentiviral Particle
RC226349L3V

USD 1,630.00

6 Weeks

Lenti ORF particles, LAMB3 (Myc-DDK-tagged)-Human laminin, beta 3 (LAMB3), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Laminin 5 (LAMB3) (NM_001127641) Human Tagged ORF Clone
RC226349L4

USD 1,430.00

3 Weeks

Lenti-ORF clone of LAMB3 (mGFP-tagged)-Human laminin, beta 3 (LAMB3), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Laminin 5 (LAMB3) (NM_001017402) Human Tagged ORF Clone
RG210050

USD 1,350.00

3 Weeks

LAMB3 (GFP-tagged) - Human laminin, beta 3 (LAMB3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Laminin 5 (LAMB3) (NM_001127641) Human Tagged ORF Clone
RG226349

USD 1,350.00

3 Weeks

LAMB3 (GFP-tagged) - Human laminin, beta 3 (LAMB3), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Lamb3 (NM_001100841) Rat Tagged ORF Clone
RR217523

USD 1,190.00

7 Weeks

Lamb3 (myc-DDK-tagged) - Rat laminin, beta 3 (Lamb3)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Laminin 5 (LAMB3) Rabbit Polyclonal Antibody
TA308917

USD 415.00

2 Weeks

Rabbit Polyclonal antibody to Laminin beta 3 (laminin, beta 3)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 644 and 960 of Laminin beta 3 (Uniprot ID#Q13751)
Laminin 5 (LAMB3) (NM_001017402) Human Untagged Clone
SC302037

USD 1,100.00

In Stock

LAMB3 (untagged)-Human laminin, beta 3 (LAMB3), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Laminin 5 (LAMB3) Rabbit Polyclonal Antibody
TA313358

USD 345.00

In Stock

Rabbit polyclonal anti-LAMB3 antibody

Applications IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human LAMB3.
Laminin 5 (LAMB3) Rabbit Polyclonal Antibody
TA346167

USD 475.00

5 Days

Rabbit Polyclonal Anti-LAMB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LAMB3 antibody: synthetic peptide directed towards the middle region of human LAMB3. Synthetic peptide located within the following region: ERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKD
Laminin 5 (LAMB3) (NM_000228) Human Over-expression Lysate
LC424856

USD 187.00

In Stock

LAMB3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Laminin 5 (LAMB3) (NM_001127641) Human Over-expression Lysate
LC426828

USD 187.00

In Stock

LAMB3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Laminin 5 (LAMB3) (NM_000228) Human Over-expression Lysate
LY424856

USD 605.00

In Stock

Transient overexpression lysate of laminin, beta 3 (LAMB3), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Laminin 5 (LAMB3) (NM_000228) Human Untagged Clone
SC300029

USD 1,100.00

2 Weeks

LAMB3 (untagged)-Human laminin, beta 3 (LAMB3), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Laminin 5 (LAMB3) Mouse Monoclonal Antibody [Clone ID: OTI3A2]
CF804424

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) LAMB3 mouse monoclonal antibody, clone OTI3A2 (formerly 3A2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Laminin 5 (LAMB3) Mouse Monoclonal Antibody [Clone ID: OTI1E7]
CF804425

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) Purified LAMB3 mouse monoclonal antibody, clone OTI1E7 (formerly 1E7)

Applications WB
Reactivities Human
Conjugation Unconjugated
Laminin 5 (LAMB3) Mouse Monoclonal Antibody [Clone ID: OTI8H5]
CF804756

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) LAMB3 mouse monoclonal antibody, clone OTI8H5 (formerly 8H5)

Applications WB
Reactivities Human
Conjugation Unconjugated
Laminin 5 (LAMB3) Mouse Monoclonal Antibody [Clone ID: OTI9G3]
CF805986

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) LAMB3 mouse monoclonal antibody, clone OTI9G3 (formerly 9G3)

Applications WB
Reactivities Human
Conjugation Unconjugated
Laminin 5 (LAMB3) Mouse Monoclonal Antibody [Clone ID: OTI1H10]
CF806059

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) LAMB3 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Laminin 5 (LAMB3) Mouse Monoclonal Antibody [Clone ID: OTI1D3]
CF806062

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) LAMB3 mouse monoclonal antibody, clone OTI1D3 (formerly 1D3)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Human Laminin 5 (LAMB3) activation kit by CRISPRa
GA102655

USD 1,290.00

2 Weeks

LAMB3 CRISPRa kit - CRISPR gene activation of human laminin subunit beta 3

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Lamb3 activation kit by CRISPRa
GA202409

USD 1,290.00

2 Weeks

Lamb3 CRISPRa kit - CRISPR gene activation of mouse laminin, beta 3

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Laminin 5 (LAMB3) Human qPCR Template Standard (NM_001017402)
HK208633

USD 440.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene LAMB3

Application Plasmid of exact quantity for transcript copy number calculation
Laminin 5 (LAMB3) Human qPCR Primer Pair (NM_000228)
HP200211

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene LAMB3

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
Laminin 5 (LAMB3) (NM_001127641) Human Over-expression Lysate
LY426828

USD 605.00

5 Days

Transient overexpression lysate of laminin, beta 3 (LAMB3), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Lamb3 (NM_008484) Mouse Untagged Clone
MC223783

USD 1,580.00

6 Weeks

Lamb3 (untagged) - Mouse laminin, beta 3 (Lamb3), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Lamb3 (NM_001277928) Mouse Untagged Clone
MC229434

USD 1,180.00

5 Weeks

Lamb3 (untagged) - Mouse laminin, beta 3 (Lamb3), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Lamb3 Mouse qPCR Primer Pair (NM_008484)
MP207285

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Lamb3

Lamb3 (NM_001100841) Rat Untagged Clone
RN217523

USD 1,190.00

6 Weeks

Lamb3 (untagged) - Rat laminin, beta 3 (Lamb3)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Laminin 5 (LAMB3) (NM_001017402) Human 3' UTR Clone
SC205796

USD 560.00

4 Weeks

3`UTR clone of laminin beta 3 (LAMB3) transcript variant 2 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase