Products

View as table Download

Rabbit Polyclonal Anti-MSTN Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Mstn antibody is: synthetic peptide directed towards the C-terminal region of Mouse Mstn. Synthetic peptide located within the following region: APKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPIN

Purified recombinant protein of Human myostatin (MSTN).

Tag Tag Free
Expression Host E. coli

Purified recombinant protein of Human myostatin (MSTN).

Tag Tag Free
Expression Host E. coli

MSTN HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

Myostatin (His-tagged Fusion Protein) human protein, 0.1 mg

Tag His-tag
Expression Host E. coli

Rabbit anti GDF-8 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated

Myostatin (267-375, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli

Myostatin (267-375, His-tag) human recombinant protein, 20 µg

Tag His-tag
Expression Host E. coli

Carrier-free (BSA/glycerol-free) MSTN mouse monoclonal antibody, clone OTI4F9 (formerly 4F9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MSTN mouse monoclonal antibody, clone OTI6A7 (formerly 6A7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MSTN mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MSTN MS Standard C13 and N15-labeled recombinant protein (NP_005250)

Tag C-Myc/DDK
Expression Host HEK293

Anti-MSTN Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 354-366 amino acids of Human myostatin

MSTN mouse monoclonal antibody, clone OTI7H5 (formerly 7H5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: “NEURO15".

MSTN mouse monoclonal antibody, clone OTI4F9 (formerly 4F9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MSTN mouse monoclonal antibody, clone OTI6A7 (formerly 6A7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MSTN mouse monoclonal antibody, clone OTI3A7 (formerly 3A7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: “NEURO15".

MSTN mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Transient overexpression of MSTN (NM_005259) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of MSTN (NM_005259) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack