Products

cDNA Clones (35)
Proteins (22)
Antibodies (2)
Jump to Filters
View as table Download
SPOCK3 (NM_001040159) Human Tagged ORF Clone
RC204228

USD 420.00

In Stock

SPOCK3 (Myc-DDK-tagged)-Human sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 (SPOCK3), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SPOCK3 (NM_016950) Human Tagged ORF Clone
RC221304

USD 420.00

In Stock

SPOCK3 (Myc-DDK-tagged)-Human sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 (SPOCK3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SPOCK3 (NM_001040159) Human Tagged ORF Clone
RG204228

USD 460.00

In Stock

SPOCK3 (GFP-tagged) - Human sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 (SPOCK3), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SPOCK3 (NM_001040159) Human Tagged ORF Clone
RC204228L3

USD 620.00

3 Weeks

Lenti ORF clone of Human sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 (SPOCK3), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SPOCK3 (NM_001040159) Human Tagged ORF Clone Lentiviral Particle
RC204228L3V

USD 820.00

6 Weeks

Lenti ORF particles, SPOCK3 (Myc-DDK tagged) - Human sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 (SPOCK3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SPOCK3 (NM_001040159) Human Tagged ORF Clone
RC204228L4

USD 620.00

3 Weeks

Lenti ORF clone of Human sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 (SPOCK3), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SPOCK3 (NM_001040159) Human Tagged ORF Clone Lentiviral Particle
RC204228L4V

USD 820.00

6 Weeks

Lenti ORF particles, SPOCK3 (mGFP-tagged) - Human sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 (SPOCK3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SPOCK3 (NM_016950) Human Tagged ORF Clone
RC221304L3

USD 620.00

3 Weeks

Lenti-ORF clone of SPOCK3 (Myc-DDK-tagged)-Human sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 (SPOCK3), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SPOCK3 (NM_016950) Human Tagged ORF Clone Lentiviral Particle
RC221304L3V

USD 820.00

6 Weeks

Lenti ORF particles, SPOCK3 (Myc-DDK-tagged)-Human sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 (SPOCK3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SPOCK3 (NM_016950) Human Tagged ORF Clone
RC221304L4

USD 620.00

3 Weeks

Lenti-ORF clone of SPOCK3 (mGFP-tagged)-Human sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 (SPOCK3), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SPOCK3 (NM_016950) Human Tagged ORF Clone Lentiviral Particle
RC221304L4V

USD 820.00

6 Weeks

Lenti ORF particles, SPOCK3 (mGFP-tagged)-Human sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 (SPOCK3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SPOCK3 (NM_001204358) Human Tagged ORF Clone
RC232456

USD 420.00

3 Weeks

SPOCK3 (Myc-DDK tagged) - Homo sapiens sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 (SPOCK3), transcript variant 9

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SPOCK3 (NM_001204353) Human Tagged ORF Clone
RC233740

USD 420.00

3 Weeks

SPOCK3 (Myc-DDK tagged) - Homo sapiens sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 (SPOCK3), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SPOCK3 (NM_001251967) Human Tagged ORF Clone
RC233812

USD 420.00

5 Weeks

SPOCK3 (Myc-DDK tagged) - Homo sapiens sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 (SPOCK3), transcript variant 11

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SPOCK3 (NM_001204355) Human Tagged ORF Clone
RC233816

USD 420.00

5 Weeks

SPOCK3 (Myc-DDK tagged) - Homo sapiens sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 (SPOCK3), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SPOCK3 (NM_001204354) Human Tagged ORF Clone
RC233828

USD 420.00

5 Weeks

SPOCK3 (Myc-DDK tagged) - Homo sapiens sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 (SPOCK3), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SPOCK3 (NM_001204352) Human Tagged ORF Clone
RC233942

USD 420.00

5 Weeks

SPOCK3 (Myc-DDK tagged) - Homo sapiens sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 (SPOCK3), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SPOCK3 (NM_001204356) Human Tagged ORF Clone
RC233969

USD 420.00

5 Weeks

SPOCK3 (Myc-DDK tagged) - Homo sapiens sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 (SPOCK3), transcript variant 7

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SPOCK3 (NM_016950) Human Tagged ORF Clone
RG221304

USD 460.00

3 Weeks

SPOCK3 (GFP-tagged) - Human sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 (SPOCK3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SPOCK3 (NM_001204358) Human Tagged ORF Clone
RG232456

USD 460.00

3 Weeks

SPOCK3 (GFP-tagged) - Homo sapiens sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 (SPOCK3), transcript variant 9

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SPOCK3 (NM_001204353) Human Tagged ORF Clone
RG233740

USD 460.00

3 Weeks

SPOCK3 (GFP-tagged) - Homo sapiens sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 (SPOCK3), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SPOCK3 (NM_001251967) Human Tagged ORF Clone
RG233812

USD 460.00

5 Weeks

SPOCK3 (GFP-tagged) - Homo sapiens sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 (SPOCK3), transcript variant 11

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SPOCK3 (NM_001204355) Human Tagged ORF Clone
RG233816

USD 460.00

5 Weeks

SPOCK3 (GFP-tagged) - Homo sapiens sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 (SPOCK3), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SPOCK3 (NM_001204354) Human Tagged ORF Clone
RG233828

USD 460.00

5 Weeks

SPOCK3 (GFP-tagged) - Homo sapiens sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 (SPOCK3), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SPOCK3 (NM_001204352) Human Tagged ORF Clone
RG233942

USD 460.00

5 Weeks

SPOCK3 (GFP-tagged) - Homo sapiens sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 (SPOCK3), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SPOCK3 (NM_001204356) Human Tagged ORF Clone
RG233969

USD 460.00

5 Weeks

SPOCK3 (GFP-tagged) - Homo sapiens sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 (SPOCK3), transcript variant 7

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SPOCK3 (NM_001040159) Human Untagged Clone
SC324461

USD 760.00

In Stock

SPOCK3 (untagged)-Human sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 (SPOCK3), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
SPOCK3 (NM_001040159) Human Over-expression Lysate
LY421701

USD 396.00

5 Days

Transient overexpression lysate of sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 (SPOCK3), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SPOCK3 Rabbit Polyclonal Antibody
TA335970

USD 375.00

5 Days

Rabbit Polyclonal Anti-SPOCK3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SPOCK3 Antibody: synthetic peptide directed towards the middle region of human SPOCK3. Synthetic peptide located within the following region: CPCPSDKPTSTSRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKTKT
SPOCK3 Rabbit Polyclonal Antibody
TA335971

USD 375.00

5 Days

Rabbit Polyclonal Anti-SPOCK3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SPOCK3 Antibody: synthetic peptide directed towards the middle region of human SPOCK3. Synthetic peptide located within the following region: VDRYGNEVMGSRINGVADCAIDFEISGDFASGDFHEWTDDEDDEDDIMND
SPOCK3 (NM_001040159) Human Over-expression Lysate
LC421701

USD 121.00

2 Weeks

SPOCK3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SPOCK3 (NM_016950) Human Untagged Clone
SC313459

USD 740.00

4 Weeks

SPOCK3 (untagged)-Human sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 (SPOCK3), transcript variant 2

Vector pCMV6 series
Tag Tag Free
SPOCK3 (NM_001204358) Human Untagged Clone
SC329738

USD 320.00

3 Weeks

SPOCK3 (untagged) - Homo sapiens sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 (SPOCK3), transcript variant 9

Vector pCMV6 series
Tag Tag Free
SPOCK3 (NM_001204352) Human Untagged Clone
SC331563

USD 390.00

5 Weeks

SPOCK3 (untagged) - Homo sapiens sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 (SPOCK3), transcript variant 3

Vector pCMV6 series
Tag Tag Free
SPOCK3 (NM_001204353) Human Untagged Clone
SC331564

USD 330.00

3 Weeks

SPOCK3 (untagged) - Homo sapiens sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 (SPOCK3), transcript variant 4

Vector pCMV6 series
Tag Tag Free
SPOCK3 (NM_001204354) Human Untagged Clone
SC331565

USD 350.00

5 Weeks

SPOCK3 (untagged) - Homo sapiens sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 (SPOCK3), transcript variant 5

Vector pCMV6 series
Tag Tag Free
SPOCK3 (NM_001204355) Human Untagged Clone
SC331566

USD 350.00

5 Weeks

SPOCK3 (untagged) - Homo sapiens sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 (SPOCK3), transcript variant 6

Vector pCMV6 series
Tag Tag Free
SPOCK3 (NM_001204356) Human Untagged Clone
SC331567

USD 390.00

5 Weeks

SPOCK3 (untagged) - Homo sapiens sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 (SPOCK3), transcript variant 7

Vector pCMV6 series
Tag Tag Free
SPOCK3 (NM_001251967) Human Untagged Clone
SC332152

USD 350.00

5 Weeks

SPOCK3 (untagged) - Homo sapiens sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 (SPOCK3), transcript variant 11

Vector pCMV6 series
Tag Tag Free
SPOCK3 (NM_001040159) ICC Control Block
TB404228

USD 1,070.00

4 Weeks

Transient overexpression of SPOCK3 (NM_001040159) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SPOCK3 (NM_016950) ICC Control Block
TB421304

USD 1,070.00

4 Weeks

Transient overexpression of SPOCK3 (NM_016950) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SPOCK3 (NM_001204358) ICC Control Block
TB432456

USD 1,070.00

4 Weeks

Transient overexpression of SPOCK3 (NM_001204358) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SPOCK3 (NM_001204353) ICC Control Block
TB433740

USD 1,070.00

4 Weeks

Transient overexpression of SPOCK3 (NM_001204353) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SPOCK3 (NM_001251967) ICC Control Block
TB433812

USD 1,070.00

4 Weeks

Transient overexpression of SPOCK3 (NM_001251967) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SPOCK3 (NM_001204355) ICC Control Block
TB433816

USD 1,070.00

4 Weeks

Transient overexpression of SPOCK3 (NM_001204355) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SPOCK3 (NM_001204354) ICC Control Block
TB433828

USD 1,070.00

4 Weeks

Transient overexpression of SPOCK3 (NM_001204354) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SPOCK3 (NM_001204352) ICC Control Block
TB433942

USD 1,070.00

4 Weeks

Transient overexpression of SPOCK3 (NM_001204352) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SPOCK3 (NM_001204356) ICC Control Block
TB433969

USD 1,070.00

4 Weeks

Transient overexpression of SPOCK3 (NM_001204356) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SPOCK3 Cytosection
TS404228

USD 225.00

4 Weeks

Transient overexpression of SPOCK3 (NM_001040159) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

SPOCK3 Cytosection
TS404228P5

USD 889.00

4 Weeks

Transient overexpression of SPOCK3 (NM_001040159) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack