Germany
Japan
United Kingdom
China
PHGDH (Myc-DDK-tagged)-Human phosphoglycerate dehydrogenase (PHGDH)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human phosphoglycerate dehydrogenase (PHGDH)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, PHGDH (Myc-DDK tagged) - Human phosphoglycerate dehydrogenase (PHGDH), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, PHGDH (mGFP-tagged) - Human phosphoglycerate dehydrogenase (PHGDH), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
PHGDH (GFP-tagged) - Human phosphoglycerate dehydrogenase (PHGDH)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human phosphoglycerate dehydrogenase (PHGDH), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PHGDH (Myc-DDK tagged) - Human phosphoglycerate dehydrogenase (PHGDH), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, PHGDH (mGFP-tagged) - Human phosphoglycerate dehydrogenase (PHGDH), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PHGDH (untagged)-Human phosphoglycerate dehydrogenase (PHGDH)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human phosphoglycerate dehydrogenase (PHGDH), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human phosphoglycerate dehydrogenase (PHGDH), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human phosphoglycerate dehydrogenase (PHGDH), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Transient overexpression lysate of phosphoglycerate dehydrogenase (PHGDH)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PHGDH (untagged)-Human phosphoglycerate dehydrogenase (PHGDH)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Recombinant protein of human phosphoglycerate dehydrogenase (PHGDH), full length, with C-terminal DDK tag, expressed in sf9, 20ug
| Tag | C-DDK |
| Expression Host | Sf9 |
PHGDH HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Recombinant protein of human phosphoglycerate dehydrogenase (PHGDH), full length, with N-terminal HIS tag, expressed in sf9, 20ug
| Tag | N-His |
| Expression Host | Sf9 |
PHGDH (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human PHGDH |
Rabbit Polyclonal Anti-PHGDH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHGDH antibody: synthetic peptide directed towards the middle region of human PHGDH. Synthetic peptide located within the following region: CAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQF |
Rabbit Polyclonal Anti-PHGDH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHGDH antibody: synthetic peptide directed towards the middle region of human PHGDH. Synthetic peptide located within the following region: SLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPA |
PHGDH MS Standard C13 and N15-labeled recombinant protein (NP_006614)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Rabbit Polyclonal Anti-PHGDH Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PHGDH |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Transient overexpression of PHGDH (NM_006623) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PHGDH (NM_006623) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PHGDH (NM_006623) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Families
- Stem cell - Pluripotency
Pathways
- Glycine