Germany
Japan
United Kingdom
China
CDC45 (Myc-DDK-tagged)-Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human CDC45 cell division cycle 45-like (S. cerevisiae) (CDC45L)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
CDC45 (GFP-tagged) - Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CDC45 (Myc-DDK-tagged)-Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CDC45 (Myc-DDK-tagged)-Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, CDC45 (Myc-DDK tagged) - Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, CDC45 (mGFP-tagged) - Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of CDC45 (Myc-DDK-tagged)-Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 3
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 870.00
6 Weeks
Lenti ORF particles, CDC45 (Myc-DDK-tagged)-Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of CDC45 (mGFP-tagged)-Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 3
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 870.00
6 Weeks
Lenti ORF particles, CDC45 (mGFP-tagged)-Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of CDC45 (Myc-DDK-tagged)-Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 880.00
6 Weeks
Lenti ORF particles, CDC45 (Myc-DDK-tagged)-Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of CDC45 (mGFP-tagged)-Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 880.00
6 Weeks
Lenti ORF particles, CDC45 (mGFP-tagged)-Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CDC45 (GFP-tagged) - Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CDC45 (GFP-tagged) - Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CDC45 (untagged)-Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
CDC45 (untagged)-Human cell division cycle 45 homolog (S. cerevisiae) (CDC45) transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
CDC45 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-CDC45
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC45L antibody: synthetic peptide directed towards the C terminal of human CDC45L. Synthetic peptide located within the following region: VTVVGIPPETDSSDRKNFFGRAFEKAAESTSSRMLHNHFDLSVIELKAED |
Carrier-free (BSA/glycerol-free) CDC45 mouse monoclonal antibody,clone OTI8A1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Transient overexpression lysate of CDC45 cell division cycle 45-like (S. cerevisiae) (CDC45L)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CDC45 MS Standard C13 and N15-labeled recombinant protein (NP_003495)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
CDC45 (untagged)-Human cell division cycle 45 homolog (S. cerevisiae) (CDC45) transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
CDC45 mouse monoclonal antibody,clone OTI8A1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
CDC45 mouse monoclonal antibody,clone OTI8A1, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
CDC45 mouse monoclonal antibody,clone OTI8A1, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
CDC45 mouse monoclonal antibody,clone OTI8A1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Transient overexpression of CDC45 (NM_003504) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CDC45 (NM_001178011) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CDC45 (NM_001178010) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CDC45 (NM_003504) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CDC45 (NM_003504) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CDC45 (NM_001178011) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CDC45 (NM_001178011) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CDC45 (NM_001178010) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CDC45 (NM_001178010) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CDC45
Families
- Stem cell - Pluripotency