CDC45 (Myc-DDK-tagged)-Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CDC45 (Myc-DDK-tagged)-Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human CDC45 cell division cycle 45-like (S. cerevisiae) (CDC45L)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
CDC45 (GFP-tagged) - Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CDC45 (Myc-DDK-tagged)-Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CDC45 (Myc-DDK-tagged)-Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, CDC45 (Myc-DDK tagged) - Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, CDC45 (mGFP-tagged) - Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of CDC45 (Myc-DDK-tagged)-Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 870.00
6 Weeks
Lenti ORF particles, CDC45 (Myc-DDK-tagged)-Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of CDC45 (mGFP-tagged)-Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 870.00
6 Weeks
Lenti ORF particles, CDC45 (mGFP-tagged)-Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of CDC45 (Myc-DDK-tagged)-Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 880.00
6 Weeks
Lenti ORF particles, CDC45 (Myc-DDK-tagged)-Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of CDC45 (mGFP-tagged)-Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 880.00
6 Weeks
Lenti ORF particles, CDC45 (mGFP-tagged)-Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CDC45 (GFP-tagged) - Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CDC45 (GFP-tagged) - Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CDC45 (untagged)-Human cell division cycle 45 homolog (S. cerevisiae) (CDC45), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
CDC45 (untagged)-Human cell division cycle 45 homolog (S. cerevisiae) (CDC45) transcript variant 1
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
CDC45 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit polyclonal antibody to CDC45L (CDC45 cell division cycle 45-like (S. cerevisiae))
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 298 and 566 of CDC45L (Uniprot ID#O75419) |
Rabbit Polyclonal Anti-CDC45
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDC45L antibody: synthetic peptide directed towards the C terminal of human CDC45L. Synthetic peptide located within the following region: VTVVGIPPETDSSDRKNFFGRAFEKAAESTSSRMLHNHFDLSVIELKAED |
Carrier-free (BSA/glycerol-free) CDC45 mouse monoclonal antibody,clone OTI4F3
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CDC45 mouse monoclonal antibody,clone OTI8A1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression lysate of CDC45 cell division cycle 45-like (S. cerevisiae) (CDC45L)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CDC45 MS Standard C13 and N15-labeled recombinant protein (NP_003495)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
CDC45 (untagged)-Human cell division cycle 45 homolog (S. cerevisiae) (CDC45) transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
CDC45 mouse monoclonal antibody,clone OTI4F3
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CDC45 mouse monoclonal antibody,clone OTI4F3, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
CDC45 mouse monoclonal antibody,clone OTI4F3, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
CDC45 mouse monoclonal antibody,clone OTI4F3
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CDC45 mouse monoclonal antibody,clone OTI8A1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CDC45 mouse monoclonal antibody,clone OTI8A1, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
CDC45 mouse monoclonal antibody,clone OTI8A1, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
CDC45 mouse monoclonal antibody,clone OTI8A1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of CDC45 (NM_003504) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CDC45 (NM_001178011) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CDC45 (NM_001178010) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CDC45 (NM_003504) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CDC45 (NM_003504) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CDC45 (NM_001178011) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CDC45 (NM_001178011) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CDC45 (NM_001178010) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CDC45 (NM_001178010) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack