Germany
Japan
United Kingdom
China
HSPE1 (Myc-DDK-tagged)-Human heat shock 10kDa protein 1 (chaperonin 10) (HSPE1), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human heat shock 10kDa protein 1 (chaperonin 10) (HSPE1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
HSPE1 (GFP-tagged) - Human heat shock 10kDa protein 1 (chaperonin 10) (HSPE1), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, HSPE1 (Myc-DDK tagged) - Human heat shock 10kDa protein 1 (chaperonin 10) (HSPE1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, HSPE1 (mGFP-tagged) - Human heat shock 10kDa protein 1 (chaperonin 10) (HSPE1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
HSPE1 (untagged)-Human heat shock 10kDa protein 1 (chaperonin 10) (HSPE1), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-HSP10 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSP10 Antibody: A synthesized peptide derived from human HSP10 |
HSPE1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-HSPE1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPE1 antibody: synthetic peptide directed towards the middle region of human HSPE1. Synthetic peptide located within the following region: GKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD |
HSP10 (1-102) (recombinant) human recombinant protein, 0.5 mg
| Expression Host | E. coli |
HSP10 (1-102) (recombinant) human recombinant protein, 0.1 mg
| Expression Host | E. coli |
Transient overexpression lysate of heat shock 10kDa protein 1 (chaperonin 10) (HSPE1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
HSPE1 MS Standard C13 and N15-labeled recombinant protein (NP_002148)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of HSPE1 (NM_002157) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HSPE1 (NM_002157) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of HSPE1 (NM_002157) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- HSPE1
Families
- Stem cell - Pluripotency