Germany
Japan
United Kingdom
China
NTHL1 (Myc-DDK-tagged)-Human nth endonuclease III-like 1 (E. coli) (NTHL1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
NTHL1 (GFP-tagged) - Human nth endonuclease III-like 1 (E. coli) (NTHL1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human nth endonuclease III-like 1 (E. coli) (NTHL1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NTHL1 (Myc-DDK tagged) - Human nth endonuclease III-like 1 (E. coli) (NTHL1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human nth endonuclease III-like 1 (E. coli) (NTHL1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NTHL1 (mGFP-tagged) - Human nth endonuclease III-like 1 (E. coli) (NTHL1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Purified recombinant protein of Human nth endonuclease III-like 1 (E. coli) (NTHL1), full length, with N-terminal HIS tag, expressed in E. coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
NTHL1 (untagged)-Human nth endonuclease III-like 1 (E. coli) (NTHL1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
NTHL1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
NTH1 (NTHL1) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 95-126 amino acids from the Central region of human NTHL1 |
Rabbit Polyclonal Anti-NTHL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NTHL1 antibody is: synthetic peptide directed towards the N-terminal region of Human NTHL1. Synthetic peptide located within the following region: DWQQQLVNIRAMRNKKDAPVDHLGTEHCYDSSAPPKVRRYQVLLSLMLSS |
NTH1 (1-312, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
NTH1 (1-312, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
Transient overexpression lysate of nth endonuclease III-like 1 (E. coli) (NTHL1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
NTHL1 MS Standard C13 and N15-labeled recombinant protein (NP_002519)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of NTHL1 (NM_002528) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NTHL1 (NM_002528) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of NTHL1 (NM_002528) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- NTHL1
Families
- Stem cell - Pluripotency