TUBA3C (Myc-DDK-tagged)-Human tubulin, alpha 3c (TUBA3C), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TUBA3C (Myc-DDK-tagged)-Human tubulin, alpha 3c (TUBA3C), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TUBA3C (Myc-DDK-tagged)-Human tubulin, alpha 3c (TUBA3C)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human tubulin, alpha 3c (TUBA3C), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
TUBA3C (GFP-tagged) - Human tubulin, alpha 3c (TUBA3C), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human tubulin, alpha 3c (TUBA3C), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 840.00
6 Weeks
Lenti ORF particles, TUBA3C (Myc-DDK tagged) - Human tubulin, alpha 3c (TUBA3C), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human tubulin, alpha 3c (TUBA3C), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 840.00
6 Weeks
Lenti ORF particles, TUBA3C (mGFP-tagged) - Human tubulin, alpha 3c (TUBA3C), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of TUBA3C (Myc-DDK-tagged)-Human tubulin, alpha 3c (TUBA3C)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, TUBA3C (Myc-DDK-tagged)-Human tubulin, alpha 3c (TUBA3C), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of TUBA3C (mGFP-tagged)-Human tubulin, alpha 3c (TUBA3C)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, TUBA3C (mGFP-tagged)-Human tubulin, alpha 3c (TUBA3C), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
TUBA3C (GFP-tagged) - Human tubulin, alpha 3c (TUBA3C)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-UVRAG Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | UVRAG antibody was raised against an 18 amino acid peptide near the carboxy terminus of human UVRAG. |
TUBA3D mouse monoclonal antibody, clone 3F10-2F2
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
TUBA3C HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of tubulin, alpha 3c (TUBA3C)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
TUBA3C (untagged)-Human tubulin, alpha 3c (TUBA3C), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-TUBA3C Antibody
Applications | WB |
Reactivities | Human |
Immunogen | The immunogen for Anti-TUBA3C Antibody: synthetic peptide directed towards the N terminal of human TUBA3C. Synthetic peptide located within the following region: VDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDL |
Rabbit Polyclonal Alpha-tubulin Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Rabbit polyclonal Tubulin antibody was raised against a 16 amino acid peptide near the amino terminus of human Tubulin. |
Rabbit Polyclonal Anti-TUBA3C Antibody
Applications | WB |
Reactivities | Human |
Immunogen | The immunogen for Anti-TUBA3C Antibody: synthetic peptide directed towards the N terminal of human TUBA3C. Synthetic peptide located within the following region: QMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYR |
TUBA3C HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of tubulin, alpha 3c (TUBA3C), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
TUBA3C MS Standard C13 and N15-labeled recombinant protein (NP_524575)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
TUBA3C (untagged)-Human tubulin, alpha 3c (TUBA3C)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of TUBA3C (NM_079836) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TUBA3C (NM_006001) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TUBA3C (NM_079836) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TUBA3C (NM_079836) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of TUBA3C (NM_006001) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TUBA3C (NM_006001) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack