NLK (Myc-DDK-tagged)-Human nemo-like kinase (NLK)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
NLK (Myc-DDK-tagged)-Human nemo-like kinase (NLK)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human nemo-like kinase (NLK)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, NLK (Myc-DDK tagged) - Human nemo-like kinase (NLK), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, NLK (mGFP-tagged) - Human nemo-like kinase (NLK), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
NLK (GFP-tagged) - Human nemo-like kinase (NLK)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, NLK (Myc-DDK tagged) - Human nemo-like kinase (NLK), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human nemo-like kinase (NLK), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, NLK (mGFP-tagged) - Human nemo-like kinase (NLK), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit anti-NLK Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NLK |
Lenti ORF clone of Human nemo-like kinase (NLK), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human nemo-like kinase (NLK), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
NLK (untagged)-Human nemo-like kinase (NLK)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal antibody to NLK (nemo-like kinase)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 234 and 527 of NLK (Uniprot ID#Q9UBE8) |
NLK (untagged)-Human nemo-like kinase (NLK)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of nemo-like kinase (NLK)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-NLK Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NLK antibody: synthetic peptide directed towards the middle region of human NLK. Synthetic peptide located within the following region: RLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEI |
Lenti ORF clone of Human nemo-like kinase (NLK), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
NLK (untagged)-Kinase deficient mutant (K155M) of Human nemo-like kinase (NLK)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
NLK HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Mouse monoclonal NLK Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
NLK MS Standard C13 and N15-labeled recombinant protein (NP_057315)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
NLK (untagged)-Human nemo-like kinase (NLK)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of NLK (NM_016231) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NLK (NM_016231) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of NLK (NM_016231) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack