NKX6 (Myc-DDK-tagged)-Human NK6 homeobox 1 (NKX6-1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
NKX6 (Myc-DDK-tagged)-Human NK6 homeobox 1 (NKX6-1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, NKX6 (Myc-DDK tagged) - Human NK6 homeobox 1 (NKX6-1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
3 Weeks
Lenti ORF particles, NKX6 (mGFP-tagged) - Human NK6 homeobox 1 (NKX6-1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
NKX6 (GFP-tagged) - Human NK6 homeobox 1 (NKX6-1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human NK6 homeobox 1 (NKX6-1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, NKX6 (Myc-DDK tagged) - Human NK6 homeobox 1 (NKX6-1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, NKX6 (mGFP-tagged) - Human NK6 homeobox 1 (NKX6-1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Nkx6.1 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A genomic peptide made to an internal region of the human Nkx6.1 protein (within residues 50-200). [Swiss-Prot P78426] |
NKX6 (untagged)-Human NK6 homeobox 1 (NKX6-1)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Purified recombinant protein of Human NK6 homeobox 1 (NKX6-1), full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug
Tag | N-GST and C-His |
Expression Host | E. coli |
NKX6 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Transient overexpression lysate of NK6 homeobox 1 (NKX6-1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
nkx6.1 (NKX6-1) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 284-314aa) of human NKX6-1 |
Rabbit polyclonal anti-NKX61 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human NKX6-1. |
Rabbit Polyclonal Anti-NKX6
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NKX6-1 antibody: synthetic peptide directed towards the N terminal of human NKX6-1. Synthetic peptide located within the following region: MLAVGAMEGTRQSAFLLSSPPLAALHSMAEMKTPLYPAAYPPLPAGPPSS |
Lenti ORF clone of Human NK6 homeobox 1 (NKX6-1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Transient overexpression of NKX6 (NM_006168) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NKX6 (NM_006168) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of NKX6 (NM_006168) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack