Products

cDNA Clones (24)
Proteins (10)
Antibodies (2)
Jump to Filters
View as table Download
SYBL1 (VAMP7) (NM_005638) Human Tagged ORF Clone
RC208902

USD 98.00

USD 390.00

In Stock

VAMP7 (Myc-DDK-tagged)-Human vesicle-associated membrane protein 7 (VAMP7), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SYBL1 (VAMP7) (NM_005638) Human Tagged ORF Clone
RG208902

USD 460.00

In Stock

VAMP7 (GFP-tagged) - Human vesicle-associated membrane protein 7 (VAMP7), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SYBL1 (VAMP7) (NM_005638) Human Tagged ORF Clone Lentiviral Particle
RC208902L2V

USD 820.00

6 Weeks

Lenti ORF particles, VAMP7 (mGFP-tagged)-Human vesicle-associated membrane protein 7 (VAMP7), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
SYBL1 (VAMP7) (NM_001145149) Human Tagged ORF Clone
RC227306

USD 420.00

In Stock

VAMP7 (Myc-DDK-tagged)-Human vesicle-associated membrane protein 7 (VAMP7), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SYBL1 (VAMP7) (NM_005638) Human Tagged ORF Clone
RC208902L3

USD 620.00

3 Weeks

Lenti-ORF clone of VAMP7 (Myc-DDK-tagged)-Human vesicle-associated membrane protein 7 (VAMP7), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SYBL1 (VAMP7) (NM_005638) Human Tagged ORF Clone Lentiviral Particle
RC208902L3V

USD 820.00

11 Weeks

Lenti ORF particles, VAMP7 (Myc-DDK-tagged)-Human vesicle-associated membrane protein 7 (VAMP7), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SYBL1 (VAMP7) (NM_005638) Human Tagged ORF Clone
RC208902L4

USD 620.00

3 Weeks

Lenti-ORF clone of VAMP7 (mGFP-tagged)-Human vesicle-associated membrane protein 7 (VAMP7), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SYBL1 (VAMP7) (NM_005638) Human Tagged ORF Clone Lentiviral Particle
RC208902L4V

USD 820.00

11 Weeks

Lenti ORF particles, VAMP7 (mGFP-tagged)-Human vesicle-associated membrane protein 7 (VAMP7), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SYBL1 (VAMP7) (NM_001145149) Human Tagged ORF Clone
RC227306L3

USD 620.00

3 Weeks

Lenti-ORF clone of VAMP7 (Myc-DDK-tagged)-Human vesicle-associated membrane protein 7 (VAMP7), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SYBL1 (VAMP7) (NM_001145149) Human Tagged ORF Clone Lentiviral Particle
RC227306L3V

USD 820.00

6 Weeks

Lenti ORF particles, VAMP7 (Myc-DDK-tagged)-Human vesicle-associated membrane protein 7 (VAMP7), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SYBL1 (VAMP7) (NM_001145149) Human Tagged ORF Clone
RC227306L4

USD 620.00

3 Weeks

Lenti-ORF clone of VAMP7 (mGFP-tagged)-Human vesicle-associated membrane protein 7 (VAMP7), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SYBL1 (VAMP7) (NM_001145149) Human Tagged ORF Clone Lentiviral Particle
RC227306L4V

USD 820.00

6 Weeks

Lenti ORF particles, VAMP7 (mGFP-tagged)-Human vesicle-associated membrane protein 7 (VAMP7), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SYBL1 (VAMP7) (NM_001185183) Human Tagged ORF Clone
RC231108

USD 420.00

3 Weeks

VAMP7 (Myc-DDK-tagged)-Human vesicle-associated membrane protein 7 (VAMP7), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SYBL1 (VAMP7) (NM_001185183) Human Tagged ORF Clone
RC231108L3

USD 620.00

3 Weeks

Lenti-ORF clone of VAMP7 (Myc-DDK-tagged)-Human vesicle-associated membrane protein 7 (VAMP7), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SYBL1 (VAMP7) (NM_001185183) Human Tagged ORF Clone Lentiviral Particle
RC231108L3V

USD 820.00

6 Weeks

Lenti ORF particles, VAMP7 (Myc-DDK-tagged)-Human vesicle-associated membrane protein 7 (VAMP7), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SYBL1 (VAMP7) (NM_001185183) Human Tagged ORF Clone
RC231108L4

USD 620.00

3 Weeks

Lenti-ORF clone of VAMP7 (mGFP-tagged)-Human vesicle-associated membrane protein 7 (VAMP7), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SYBL1 (VAMP7) (NM_001185183) Human Tagged ORF Clone Lentiviral Particle
RC231108L4V

USD 820.00

6 Weeks

Lenti ORF particles, VAMP7 (mGFP-tagged)-Human vesicle-associated membrane protein 7 (VAMP7), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SYBL1 (VAMP7) (NM_001145149) Human Tagged ORF Clone
RG227306

USD 460.00

3 Weeks

VAMP7 (GFP-tagged) - Human vesicle-associated membrane protein 7 (VAMP7), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SYBL1 (VAMP7) (NM_001185183) Human Tagged ORF Clone
RG231108

USD 460.00

4 Weeks

VAMP7 (GFP-tagged) - Human vesicle-associated membrane protein 7 (VAMP7), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SYBL1 (VAMP7) Rabbit Polyclonal Antibody
TA319712

USD 430.00

2 Weeks

Rabbit Polyclonal VAMP7 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen VAMP7 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human VAMP7.
SYBL1 (VAMP7) (NM_005638) Human Untagged Clone
SC116604

USD 310.00

In Stock

VAMP7 (untagged)-Human vesicle-associated membrane protein 7 (VAMP7), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
SYBL1 (VAMP7) (NM_005638) Human Tagged ORF Clone
RC208902L1

USD 620.00

In Stock

Lenti-ORF clone of VAMP7 (Myc-DDK-tagged)-Human vesicle-associated membrane protein 7 (VAMP7), transcript variant 1

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
SYBL1 (VAMP7) (NM_005638) Human Tagged ORF Clone
RC208902L2

USD 620.00

3 Weeks

Lenti-ORF clone of VAMP7 (mGFP-tagged)-Human vesicle-associated membrane protein 7 (VAMP7), transcript variant 1

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
SYBL1 (VAMP7) Rabbit Polyclonal Antibody
TA342435

USD 375.00

5 Days

Rabbit Polyclonal Anti-VAMP7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VAMP7 antibody: synthetic peptide directed towards the N terminal of human VAMP7. Synthetic peptide located within the following region: KIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFNFLNEIKK
VAMP-7 / SYBL1 (1-188, His-tag) Human Protein
AR50510PU-N

USD 845.00

2 Weeks

VAMP-7 / SYBL1 (1-188, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
VAMP-7 / SYBL1 (1-188, His-tag) Human Protein
AR50510PU-S

USD 330.00

2 Weeks

VAMP-7 / SYBL1 (1-188, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
SYBL1 (VAMP7) (NM_001145149) Human Untagged Clone
SC325567

USD 420.00

3 Weeks

VAMP7 (untagged)-Human vesicle-associated membrane protein 7 (VAMP7), transcript variant 2

Vector pCMV6 series
Tag Tag Free
SYBL1 (VAMP7) ICC Control Block
TB408902

USD 1,040.00

4 Weeks

Transient overexpression of VAMP7 (NM_005638) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SYBL1 (VAMP7) ICC Control Block
TB427306

USD 1,070.00

4 Weeks

Transient overexpression of VAMP7 (NM_001145149) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SYBL1 (VAMP7) ICC Control Block
TB431108

USD 1,070.00

4 Weeks

Transient overexpression of VAMP7 (NM_001185183) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SYBL1 (VAMP7) Cytosection
TS408902

USD 225.00

4 Weeks

Transient overexpression of VAMP7 (NM_005638) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

SYBL1 (VAMP7) Cytosection
TS408902P5

USD 889.00

4 Weeks

Transient overexpression of VAMP7 (NM_005638) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

SYBL1 (VAMP7) Cytosection
TS427306

USD 225.00

4 Weeks

Transient overexpression of VAMP7 (NM_001145149) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

SYBL1 (VAMP7) Cytosection
TS427306P5

USD 889.00

4 Weeks

Transient overexpression of VAMP7 (NM_001145149) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

SYBL1 (VAMP7) ICC Control Sections
TS431108P5

USD 889.00

4 Weeks

Transient overexpression of VAMP7 (NM_001185183) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack