Products

View as table Download

Rabbit polyclonal antibody to L3MBTL (l(3)mbt-like (Drosophila))

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 365 and 723 of L3MBTL

Rabbit Polyclonal Anti-L3MBTL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-L3MBTL Antibody: synthetic peptide directed towards the N terminal of human L3MBTL. Synthetic peptide located within the following region: RRREGHGTDSEMGQGPVRESQSSDPPALQFRISEYKPLNMAGVEQPPSPE

Rabbit Polyclonal Anti-L3MBTL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-L3MBTL antibody: synthetic peptide directed towards the N terminal of human L3MBTL. Synthetic peptide located within the following region: LLKPMKKRKRREYQSPSEEESEPEAMEKQEEGKDPEGQPTASTPESEEWS