Products

Proteins (7)
cDNA Clones (7)
Antibodies (3)
Jump to Filters
View as table Download
BUD31 (NM_003910) Human Tagged ORF Clone
RC206862

USD 98.00

USD 390.00

In Stock

BUD31 (Myc-DDK-tagged)-Human BUD31 homolog (S. cerevisiae) (BUD31)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
BUD31 (NM_003910) Human Tagged ORF Clone
RG206862

USD 460.00

In Stock

BUD31 (GFP-tagged) - Human BUD31 homolog (S. cerevisiae) (BUD31)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
BUD31 (NM_003910) Human Tagged ORF Clone
RC206862L3

USD 620.00

3 Weeks

Lenti ORF clone of Human BUD31 homolog (S. cerevisiae) (BUD31), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
BUD31 (NM_003910) Human Tagged ORF Clone
RC206862L4

USD 620.00

3 Weeks

Lenti ORF clone of Human BUD31 homolog (S. cerevisiae) (BUD31), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BUD31 (NM_003910) Human Tagged ORF Clone Lentiviral Particle
RC206862L4V

USD 820.00

6 Weeks

Lenti ORF particles, BUD31 (mGFP-tagged) - Human BUD31 homolog (S. cerevisiae) (BUD31), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BUD31 Rabbit Polyclonal Antibody
TA314832

USD 345.00

In Stock

Rabbit polyclonal anti-BUD31 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human BUD31.
BUD31 (NM_003910) Human Over-expression Lysate
LC418340

USD 121.00

In Stock

BUD31 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
BUD31 (NM_003910) Human Untagged Clone
SC117679

USD 310.00

In Stock

BUD31 (untagged)-Human BUD31 homolog (S. cerevisiae) (BUD31)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
BUD31 Rabbit Polyclonal Antibody
TA343432

USD 375.00

5 Days

Rabbit Polyclonal Anti-BUD31 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BUD31 antibody: synthetic peptide directed towards the N terminal of human BUD31. Synthetic peptide located within the following region: PKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFR
BUD31 Rabbit Polyclonal Antibody
TA343433

USD 310.00

5 Days

Rabbit Polyclonal Anti-BUD31 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BUD31 antibody: synthetic peptide directed towards the middle region of human BUD31. Synthetic peptide located within the following region: SRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICR
BUD31 / EDG2 (1-144, His-tag) Human Protein
AR50959PU-N

USD 845.00

2 Weeks

BUD31 / EDG2 (1-144, His-tag) human protein, 0.1 mg

Tag His-tag
Expression Host E. coli
BUD31 / EDG2 (1-144, His-tag) Human Protein
AR50959PU-S

USD 330.00

2 Weeks

BUD31 / EDG2 (1-144, His-tag) human protein, 20 µg

Tag His-tag
Expression Host E. coli
BUD31 (NM_003910) ICC Control Block
TB406862

USD 1,040.00

4 Weeks

Transient overexpression of BUD31 (NM_003910) in HEK293T cells paraffin embedded controls for ICC/IHC staining

BUD31 Cytosection
TS406862

USD 225.00

4 Weeks

Transient overexpression of BUD31 (NM_003910) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

BUD31 Cytosection
TS406862P5

USD 889.00

4 Weeks

Transient overexpression of BUD31 (NM_003910) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack