Germany
Japan
United Kingdom
China
BUD31 (Myc-DDK-tagged)-Human BUD31 homolog (S. cerevisiae) (BUD31)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Bud31 (Myc-DDK-tagged) - Mouse BUD31 homolog (yeast) (Bud31)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
BUD31 (GFP-tagged) - Human BUD31 homolog (S. cerevisiae) (BUD31)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
BUD31 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN406862 is the updated version of KN206862.
Bud31 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN502325 is the updated version of KN302325.
Bud31 (GFP-tagged) - Mouse BUD31 homolog (yeast) (Bud31)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Bud31 (Myc-DDK-tagged) - Mouse BUD31 homolog (yeast) (Bud31)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Bud31 (Myc-DDK-tagged) - Mouse BUD31 homolog (yeast) (Bud31), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Bud31 (mGFP-tagged) - Mouse BUD31 homolog (yeast) (Bud31)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Bud31 (GFP-tagged) - Mouse BUD31 homolog (yeast) (Bud31), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human BUD31 homolog (S. cerevisiae) (BUD31), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, BUD31 (Myc-DDK tagged) - Human BUD31 homolog (S. cerevisiae) (BUD31), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human BUD31 homolog (S. cerevisiae) (BUD31), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, BUD31 (mGFP-tagged) - Human BUD31 homolog (S. cerevisiae) (BUD31), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Bud31 (Myc-DDK-tagged ORF) - Rat BUD31 homolog (yeast) (Bud31), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Bud31 (Myc-DDK-tagged ORF) - Rat BUD31 homolog (yeast) (Bud31), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Bud31 (Myc-DDK-tagged ORF) - Rat BUD31 homolog (yeast) (Bud31), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Bud31 (mGFP-tagged ORF) - Rat BUD31 homolog (yeast) (Bud31), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Bud31 (GFP-tagged ORF) - Rat BUD31 homolog (yeast) (Bud31), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
BUD31 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit polyclonal anti-BUD31 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BUD31. |
BUD31 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of BUD31 homolog (S. cerevisiae) (BUD31)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Bud31 (untagged) - Mouse BUD31 homolog (yeast) (Bud31), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
BUD31 (untagged)-Human BUD31 homolog (S. cerevisiae) (BUD31)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
qPCR primer pairs and template standards against Homo sapiens gene BUD31
| Application | Plasmid of exact quantity for transcript copy number calculation |
Rabbit Polyclonal Anti-BUD31 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BUD31 antibody: synthetic peptide directed towards the N terminal of human BUD31. Synthetic peptide located within the following region: PKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFR |
Rabbit Polyclonal Anti-BUD31 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BUD31 antibody: synthetic peptide directed towards the middle region of human BUD31. Synthetic peptide located within the following region: SRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICR |
BUD31 / EDG2 (1-144, His-tag) human protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
BUD31 / EDG2 (1-144, His-tag) human protein, 20 µg
| Tag | His-tag |
| Expression Host | E. coli |
BUD31 CRISPRa kit - CRISPR gene activation of human BUD31 homolog
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Bud31 CRISPRa kit - CRISPR gene activation of mouse BUD31 homolog
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene BUD31
qPCR primer pairs and template standards against Mus musculus gene Bud31
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Bud31
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
AAV ORF Particles, serotype AAV-2, Bud31 (Myc-DDK-tagged) - Mouse BUD31 homolog (yeast) (Bud31), 250ul, >10^13 TU/mL
- AAV ORF®
-
AAV ORF Particles, serotype AAV-2, BUD31 (Myc-DDK-tagged)-Human BUD31 homolog (S. cerevisiae) (BUD31), 250ul, >10^13 TU/mL
- AAV ORF®
-
Bud31 (untagged ORF) - Rat BUD31 homolog (yeast) (Bud31), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of BUD31 homolog (S. cerevisiae) (BUD31) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Bud31 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Bud31 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
BUD31 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human BUD31 |
BUD31 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
BUD31 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-144 of human BUD31 (NP_003901.2). |
| Modifications | Unmodified |
Transient overexpression of BUD31 (NM_003910) in HEK293T cells paraffin embedded controls for ICC/IHC staining
BUD31 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
BUD31 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Bud31 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Bud31 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- BUD31