CBX4 (Myc-DDK-tagged)-Human chromobox homolog 4 (CBX4)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
CBX4 (Myc-DDK-tagged)-Human chromobox homolog 4 (CBX4)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, CBX4 (Myc-DDK-tagged)-Human chromobox homolog 4 (CBX4), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, CBX4 (mGFP-tagged)-Human chromobox homolog 4 (CBX4), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
CBX4 (GFP-tagged) - Human chromobox homolog 4 (CBX4)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of CBX4 (Myc-DDK-tagged)-Human chromobox homolog 4 (CBX4)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CBX4 (Myc-DDK-tagged)-Human chromobox homolog 4 (CBX4), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CBX4 (mGFP-tagged)-Human chromobox homolog 4 (CBX4), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of CBX4 (mGFP-tagged)-Human chromobox homolog 4 (CBX4)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of CBX4 (Myc-DDK-tagged)-Human chromobox homolog 4 (CBX4)
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
CBX4 (untagged)-Human chromobox homolog 4 (CBX4)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti-ORF clone of CBX4 (mGFP-tagged)-Human chromobox homolog 4 (CBX4)
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-PC2 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to aa 95-107 of Human PC2 protein. |
Rabbit Polyclonal CBX4 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CBX4 antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human CBX4. |
Rabbit Polyclonal anti-CBX4 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CBX4 antibody: synthetic peptide directed towards the N terminal of human CBX4. Synthetic peptide located within the following region: LLIAFQNRERQEQLMGYRKRGPKPKPLVVQVPTFARRSNVLTGLQDSSTD |
Rabbit anti-CBX4 polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH |
CBX4 (untagged)-Homo sapiens, clone MGC:23084 IMAGE:4856728, complete cds
Vector | pCMV6 series |
Tag | Tag Free |
Rabbit Polyclonal Anti-CBX4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CBX4 |
Transient overexpression of CBX4 (NM_003655) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CBX4 (NM_003655) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CBX4 (NM_003655) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack