E2F5 (Myc-DDK-tagged)-Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
E2F5 (Myc-DDK-tagged)-Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
E2F5 (Myc-DDK-tagged)-Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
E2F5 (GFP-tagged) - Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, E2F5 (Myc-DDK tagged) - Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, E2F5 (mGFP-tagged) - Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of E2F5 (Myc-DDK-tagged)-Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, E2F5 (Myc-DDK-tagged)-Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of E2F5 (mGFP-tagged)-Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, E2F5 (mGFP-tagged)-Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
E2F5 (Myc-DDK-tagged)-Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of E2F5 (Myc-DDK-tagged)-Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, E2F5 (Myc-DDK-tagged)-Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of E2F5 (mGFP-tagged)-Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, E2F5 (mGFP-tagged)-Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
E2F5 (GFP-tagged) - Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
E2F5 (GFP-tagged) - Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
E2F5 (untagged)-Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Purified recombinant protein of Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug
Tag | N-His |
Expression Host | E. coli |
E2F5 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal Anti-E2F5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-E2F5 antibody: synthetic peptide directed towards the N terminal of human E2F5. Synthetic peptide located within the following region: KAEIEDLELKERELDQQKLLLQQSIKNVMDDSINNRFSYVTHEDICNCFN |
Rabbit anti E2F-5 Polyclonal Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) E2F5 mouse monoclonal antibody,clone OTI1G9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) E2F5 mouse monoclonal antibody,clone OTI3B7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) E2F5 mouse monoclonal antibody,clone OTI1B8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
E2F5 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
E2F5 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of E2F transcription factor 5, p130-binding (E2F5), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of E2F transcription factor 5, p130-binding (E2F5), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
E2F5 MS Standard C13 and N15-labeled recombinant protein (NP_001942)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
E2F5 (untagged)-Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
E2F5 (untagged)-Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
E2F5 mouse monoclonal antibody,clone OTI1G9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
E2F5 mouse monoclonal antibody,clone OTI1G9, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
E2F5 mouse monoclonal antibody,clone OTI1G9, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
E2F5 mouse monoclonal antibody,clone OTI1G9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
E2F5 mouse monoclonal antibody,clone OTI3B7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
E2F5 mouse monoclonal antibody,clone OTI3B7, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
E2F5 mouse monoclonal antibody,clone OTI3B7, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
E2F5 mouse monoclonal antibody,clone OTI3B7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
E2F5 mouse monoclonal antibody,clone OTI1B8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
E2F5 mouse monoclonal antibody,clone OTI1B8, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
E2F5 mouse monoclonal antibody,clone OTI1B8, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
E2F5 mouse monoclonal antibody,clone OTI1B8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of E2F5 (NM_001083588) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of E2F5 (NM_001951) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of E2F5 (NM_001083589) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of E2F5 (NM_001083588) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of E2F5 (NM_001083588) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack