Germany
Japan
United Kingdom
China
FOXN2 (Myc-DDK-tagged)-Human forkhead box N2 (FOXN2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human forkhead box N2 (FOXN2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
FOXN2 (GFP-tagged) - Human forkhead box N2 (FOXN2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human forkhead box N2 (FOXN2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, FOXN2 (Myc-DDK tagged) - Human forkhead box N2 (FOXN2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human forkhead box N2 (FOXN2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, FOXN2 (mGFP-tagged) - Human forkhead box N2 (FOXN2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
FOXN2 (untagged)-Human forkhead box N2 (FOXN2)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of forkhead box N2 (FOXN2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
FOXN2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
FOXN2 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human FOXN2 / HTLF |
Rabbit polyclonal anti-FOXN2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human FOXN2. |
Rabbit Polyclonal Anti-HTLF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HTLF Antibody: synthetic peptide directed towards the N terminal of human HTLF. Synthetic peptide located within the following region: KRAETPGAEKIAGLSQIYKMGSLPEAVDAARPKATLVDSESADDELTNLN |
Rabbit Polyclonal Anti-HTLF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HTLF Antibody: synthetic peptide directed towards the C terminal of human HTLF. Synthetic peptide located within the following region: GKKMRKQTCQEIDEELKEAAGSLLHLAGIRTCLGSLISTAKTQNQKQRKK |
Carrier-free (BSA/glycerol-free) FOXN2 mouse monoclonal antibody,clone OTI5H8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FOXN2 mouse monoclonal antibody,clone OTI7D12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FOXN2 MS Standard C13 and N15-labeled recombinant protein (NP_002149)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
FOXN2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FOXN2 mouse monoclonal antibody,clone OTI5H8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
FOXN2 mouse monoclonal antibody,clone OTI5H8, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
FOXN2 mouse monoclonal antibody,clone OTI5H8, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
FOXN2 mouse monoclonal antibody,clone OTI5H8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FOXN2 mouse monoclonal antibody,clone OTI7D12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
FOXN2 mouse monoclonal antibody,clone OTI7D12, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
FOXN2 mouse monoclonal antibody,clone OTI7D12, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
FOXN2 mouse monoclonal antibody,clone OTI7D12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Transient overexpression of FOXN2 (NM_002158) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of FOXN2 (NM_002158) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of FOXN2 (NM_002158) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- FOXN2
Families
- Transcription Factors