MECOM (Myc-DDK-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MECOM (Myc-DDK-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MECOM (Myc-DDK-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MECOM (Myc-DDK-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 1,000.00
3 Weeks
Lenti ORF particles, MECOM (mGFP-tagged) - Human MDS1 and EVI1 complex locus (MECOM), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 1,000.00
3 Weeks
Lenti ORF particles, MECOM (Myc-DDK tagged) - Human MDS1 and EVI1 complex locus (MECOM), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 1,000.00
6 Weeks
Lenti ORF particles, MECOM (mGFP-tagged) - Human MDS1 and EVI1 complex locus (MECOM), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 1,000.00
3 Weeks
Lenti ORF particles, MECOM (Myc-DDK tagged) - Human MDS1 and EVI1 complex locus (MECOM), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 1,570.00
3 Weeks
Lenti ORF particles, MECOM (Myc-DDK-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 1,570.00
6 Weeks
Lenti ORF particles, MECOM (mGFP-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
MECOM (GFP-tagged) - Human MDS1 and EVI1 complex locus (MECOM), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
MECOM (Myc-DDK tagged) - Homo sapiens MDS1 and EVI1 complex locus (MECOM), transcript variant 7
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MECOM (GFP-tagged) - Human MDS1 and EVI1 complex locus (MECOM), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 1,000.00
3 Weeks
Lenti ORF particles, MECOM (mGFP-tagged) - Human MDS1 and EVI1 complex locus (MECOM), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
MECOM (GFP-tagged) - Human MDS1 and EVI1 complex locus (MECOM), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human MDS1 and EVI1 complex locus (MECOM), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,000.00
5 Weeks
Lenti ORF particles, MECOM (Myc-DDK tagged) - Human MDS1 and EVI1 complex locus (MECOM), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human MDS1 and EVI1 complex locus (MECOM), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,000.00
6 Weeks
Lenti ORF particles, MECOM (Myc-DDK tagged) - Human MDS1 and EVI1 complex locus (MECOM), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human MDS1 and EVI1 complex locus (MECOM), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,000.00
6 Weeks
Lenti ORF particles, MECOM (mGFP-tagged) - Human MDS1 and EVI1 complex locus (MECOM), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of MECOM (Myc-DDK-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,570.00
11 Weeks
Lenti ORF particles, MECOM (Myc-DDK-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of MECOM (mGFP-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,570.00
11 Weeks
Lenti ORF particles, MECOM (mGFP-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
MECOM (Myc-DDK-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 6
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of MECOM (Myc-DDK-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 6
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,490.00
8 Weeks
Lenti ORF particles, MECOM (Myc-DDK-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 6, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of MECOM (mGFP-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 6
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,490.00
8 Weeks
Lenti ORF particles, MECOM (mGFP-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 6, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
MECOM (Myc-DDK-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of MECOM (Myc-DDK-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 5
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,500.00
8 Weeks
Lenti ORF particles, MECOM (Myc-DDK-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 5, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of MECOM (mGFP-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 5
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,500.00
8 Weeks
Lenti ORF particles, MECOM (mGFP-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 5, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
MECOM (Myc-DDK-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of MECOM (Myc-DDK-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 4
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,700.00
9 Weeks
Lenti ORF particles, MECOM (Myc-DDK-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of MECOM (mGFP-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 4
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,700.00
9 Weeks
Lenti ORF particles, MECOM (mGFP-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
MECOM (GFP-tagged) - Human MDS1 and EVI1 complex locus (MECOM), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
MECOM (GFP-tagged) - Human MDS1 and EVI1 complex locus (MECOM), transcript variant 6
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
MECOM (GFP-tagged) - Human MDS1 and EVI1 complex locus (MECOM), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
MECOM (GFP-tagged) - Homo sapiens MDS1 and EVI1 complex locus (MECOM), transcript variant 7
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human MDS1 and EVI1 complex locus (MECOM), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
MECOM (untagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 2
Vector | pCMV6-XL6 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human MDS1 and EVI1 complex locus (MECOM), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit anti-MECOM Polyclonal Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MECOM |
Rabbit Polyclonal Anti-EVI1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EVI1 antibody: synthetic peptide directed towards the middle region of human EVI1. Synthetic peptide located within the following region: KHPSVGDNKPVELQPERSSEERPFEKISDQSESSDLDDVSTPSGSDLETT |
Rabbit Polyclonal Anti-EVI1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EVI1 antibody: synthetic peptide directed towards the middle region of human EVI1. Synthetic peptide located within the following region: KHPSVGDNKPVELQPERSSEERPFEKISDQSESSDLDDVSTPSGSDLETT |
Rabbit Polyclonal Anti-EVI1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EVI1 antibody: synthetic peptide directed towards the N terminal of human EVI1. Synthetic peptide located within the following region: VKGLSSTEQTNKSQSPLMTHPQILPATQDILKALSKHPSVGDNKPVELQP |