Recombinant protein of human nuclear receptor subfamily 2, group F, member 6 (NR2F6)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Recombinant protein of human nuclear receptor subfamily 2, group F, member 6 (NR2F6)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
NR2F6 (Myc-DDK-tagged)-Human nuclear receptor subfamily 2, group F, member 6 (NR2F6)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, NR2F6 (mGFP-tagged) - Human nuclear receptor subfamily 2, group F, member 6 (NR2F6), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, NR2F6 (Myc-DDK tagged) - Human nuclear receptor subfamily 2, group F, member 6 (NR2F6), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, NR2F6 (mGFP-tagged) - Human nuclear receptor subfamily 2, group F, member 6 (NR2F6), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
NR2F6 (GFP-tagged) - Human nuclear receptor subfamily 2, group F, member 6 (NR2F6)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, NR2F6 (Myc-DDK tagged) - Human nuclear receptor subfamily 2, group F, member 6 (NR2F6), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human nuclear receptor subfamily 2, group F, member 6 (NR2F6), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human nuclear receptor subfamily 2, group F, member 6 (NR2F6), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human nuclear receptor subfamily 2, group F, member 6 (NR2F6), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human nuclear receptor subfamily 2, group F, member 6 (NR2F6), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-NR2F6 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human NR2F6. |
Transient overexpression lysate of nuclear receptor subfamily 2, group F, member 6 (NR2F6)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
NR2F6 (untagged)-Human nuclear receptor subfamily 2, group F, member 6 (NR2F6)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
NR2F6 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Rabbit Polyclonal Anti-NR2F6 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NR2F6 antibody: synthetic peptide directed towards the N terminal of human NR2F6. Synthetic peptide located within the following region: AGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV |
NR2F6 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 24-53 amino acids from the N-terminal region of human NR2F6 |
Rabbit Polyclonal Anti-NR2F6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NR2F6 antibody: synthetic peptide directed towards the N terminal of human NR2F6. Synthetic peptide located within the following region: MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERP |
Rabbit Polyclonal Anti-NR2F6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NR2F6 antibody: synthetic peptide directed towards the N terminal of human NR2F6. Synthetic peptide located within the following region: MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERP |
Rabbit Polyclonal Anti-NR2F6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-NR2F6 Antibody: synthetic peptide directed towards the middle region of human NR2F6. Synthetic peptide located within the following region: GLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTP |
Rabbit Polyclonal Anti-NR2F6 Antibody (Ligand-binding Domain)
Applications | IHC |
Reactivities | Human |
Immunogen | EAR2 / NR2F6 antibody was raised against synthetic 16 amino acid peptide from ligand-binding domain of human NR2F6. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Bat, Pig, Platypus, Xenopus, Stickleback, Pufferfish, Zebrafish (100%); Opossum (94%). |
Carrier-free (BSA/glycerol-free) NR2F6 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NR2F6 mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NR2F6 MS Standard C13 and N15-labeled recombinant protein (NP_005225)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
NR2F6 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
NR2F6 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
NR2F6 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
NR2F6 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NR2F6 mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
NR2F6 mouse monoclonal antibody, clone OTI2H4 (formerly 2H4), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
NR2F6 mouse monoclonal antibody, clone OTI2H4 (formerly 2H4), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
NR2F6 mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of NR2F6 (NM_005234) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NR2F6 (NM_005234) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of NR2F6 (NM_005234) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack