Germany
Japan
United Kingdom
China
RARB (Myc-DDK-tagged)-Human retinoic acid receptor, beta (RARB), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
RARB (Myc-DDK-tagged)-Human retinoic acid receptor, beta (RARB), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, RARB (Myc-DDK tagged) - Human retinoic acid receptor, beta (RARB), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, RARB (mGFP-tagged) - Human retinoic acid receptor, beta (RARB), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, RARB (Myc-DDK tagged) - Human retinoic acid receptor, beta (RARB), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, RARB (mGFP-tagged) - Human retinoic acid receptor, beta (RARB), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
RARB (GFP-tagged) - Human retinoic acid receptor, beta (RARB), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human retinoic acid receptor, beta (RARB), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, RARB (Myc-DDK tagged) - Human retinoic acid receptor, beta (RARB), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human retinoic acid receptor, beta (RARB), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
7 Weeks
Lenti ORF particles, RARB (mGFP-tagged) - Human retinoic acid receptor, beta (RARB), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human retinoic acid receptor, beta (RARB), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, RARB (Myc-DDK tagged) - Human retinoic acid receptor, beta (RARB), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human retinoic acid receptor, beta (RARB), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
7 Weeks
Lenti ORF particles, RARB (mGFP-tagged) - Human retinoic acid receptor, beta (RARB), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 420.00
2 Weeks
RARB (myc-DDK-tagged) - Human retinoic acid receptor, beta (RARB), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 420.00
2 Weeks
RARB (myc-DDK-tagged) - Human retinoic acid receptor, beta (RARB), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 420.00
2 Weeks
RARB (myc-DDK-tagged) - Human retinoic acid receptor, beta (RARB), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 420.00
2 Weeks
RARB (myc-DDK-tagged) - Human retinoic acid receptor, beta (RARB), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 420.00
2 Weeks
RARB (myc-DDK-tagged) - Human retinoic acid receptor, beta (RARB), transcript variant 8
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 480.00
2 Weeks
RARB (myc-DDK-tagged) - Human retinoic acid receptor, beta (RARB), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
RARB (GFP-tagged) - Human retinoic acid receptor, beta (RARB), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
RARB (untagged)-Human retinoic acid receptor, beta (RARB), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
USD 768.00
In Stock
Lenti ORF clone of Human retinoic acid receptor, beta (RARB), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
RARB (untagged)-Human retinoic acid receptor, beta (RARB), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-RARB Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RARB |
Rabbit Polyclonal Anti-Retinoic Acid Receptor beta Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Retinoic Acid Receptor beta Antibody: A synthesized peptide derived from human Retinoic Acid Receptor beta |
USD 396.00
In Stock
Transient overexpression lysate of retinoic acid receptor, beta (RARB), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
USD 605.00
In Stock
Transient overexpression lysate of retinoic acid receptor, beta (RARB), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human retinoic acid receptor, beta (RARB), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human retinoic acid receptor, beta (RARB), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal RARB Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RARB antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 168-195 amino acids from the Central region of human RARB. |
USD 121.00
In Stock
RARB HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
USD 187.00
In Stock
RARB HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-RARB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RARB antibody: synthetic peptide directed towards the C terminal of human RARB. Synthetic peptide located within the following region: SAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPS |
USD 415.00
5 Days
Mouse Anti-Retinoic Acid Receptor, β-Isotype Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal anti-RARB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RARB antibody is: synthetic peptide directed towards the N-terminal region of Human RARB. Synthetic peptide located within the following region: EKALKACFSGLTQTEWQHRHTAQSIETQSTSSEELVPSPPSPLPPPRVYK |
USD 460.00
2 Weeks
RARB (GFP-tagged) - Human retinoic acid receptor, beta (RARB), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 460.00
2 Weeks
RARB (GFP-tagged) - Human retinoic acid receptor, beta (RARB), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 460.00
2 Weeks
RARB (GFP-tagged) - Human retinoic acid receptor, beta (RARB), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 460.00
2 Weeks
RARB (GFP-tagged) - Human retinoic acid receptor, beta (RARB), transcript variant 5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 460.00
2 Weeks
RARB (GFP-tagged) - Human retinoic acid receptor, beta (RARB), transcript variant 8
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 520.00
2 Weeks
RARB (GFP-tagged) - Human retinoic acid receptor, beta (RARB), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
RARB (untagged) - Human retinoic acid receptor, beta (RARB), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
RARB (untagged) - Human retinoic acid receptor, beta (RARB), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
RARB (untagged) - Human retinoic acid receptor, beta (RARB), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
RARB (untagged) - Human retinoic acid receptor, beta (RARB), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
RARB (untagged) - Human retinoic acid receptor, beta (RARB), transcript variant 8
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Active filters
Target Symbol
- RARB
Families
- Transcription Factors