RFXAP (Myc-DDK-tagged)-Human regulatory factor X-associated protein (RFXAP)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RFXAP (Myc-DDK-tagged)-Human regulatory factor X-associated protein (RFXAP)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of RFXAP (Myc-DDK-tagged)-Human regulatory factor X-associated protein (RFXAP)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, RFXAP (Myc-DDK-tagged)-Human regulatory factor X-associated protein (RFXAP), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of RFXAP (mGFP-tagged)-Human regulatory factor X-associated protein (RFXAP)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, RFXAP (mGFP-tagged)-Human regulatory factor X-associated protein (RFXAP), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
RFXAP (GFP-tagged) - Human regulatory factor X-associated protein (RFXAP)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal RFX-AP Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RFX-AP antibody: RFXAP (Regulatory factor X-associated protein), using the recombinant protein. |
RFXAP HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of regulatory factor X-associated protein (RFXAP)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-RFXAP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RFXAP Antibody: synthetic peptide directed towards the middle region of human RFXAP. Synthetic peptide located within the following region: SDQALNCGGTASTGSAGNVKLEESADNILSIVKQRTGSFGDRPARPTLLE |
RFXAP (untagged)-Human regulatory factor X-associated protein (RFXAP)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of RFXAP (NM_000538) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RFXAP (NM_000538) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RFXAP (NM_000538) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack