Products

cDNA Clones (38)
Proteins (25)
Antibodies (2)
Jump to Filters
View as table Download
Vgl4 (VGLL4) (NM_001128219) Human Tagged ORF Clone
RC225405

USD 420.00

In Stock

VGLL4 (Myc-DDK-tagged)-Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Vgl4 (VGLL4) (NM_014667) Human Tagged ORF Clone
RC200886

USD 98.00

USD 470.00

In Stock

VGLL4 (Myc-DDK-tagged)-Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Vgl4 (VGLL4) (NM_001128221) Human Tagged ORF Clone
RC225235

USD 420.00

In Stock

VGLL4 (Myc-DDK-tagged)-Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Vgl4 (VGLL4) (NM_014667) Human Tagged ORF Clone
RG200886

USD 460.00

In Stock

VGLL4 (GFP-tagged) - Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Vgl4 (VGLL4) (NM_014667) Human Tagged ORF Clone
RC200886L3

USD 620.00

3 Weeks

Lenti ORF clone of Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Vgl4 (VGLL4) (NM_014667) Human Tagged ORF Clone Lentiviral Particle
RC200886L3V

USD 820.00

6 Weeks

Lenti ORF particles, VGLL4 (Myc-DDK tagged) - Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Vgl4 (VGLL4) (NM_014667) Human Tagged ORF Clone
RC200886L4

USD 620.00

3 Weeks

Lenti ORF clone of Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Vgl4 (VGLL4) (NM_001128221) Human Tagged ORF Clone
RC225235L3

USD 620.00

3 Weeks

Lenti ORF clone of Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 4, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Vgl4 (VGLL4) (NM_001128221) Human Tagged ORF Clone Lentiviral Particle
RC225235L3V

USD 820.00

6 Weeks

Lenti ORF particles, VGLL4 (Myc-DDK tagged) - Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Vgl4 (VGLL4) (NM_001128221) Human Tagged ORF Clone
RC225235L4

USD 620.00

3 Weeks

Lenti ORF clone of Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 4, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Vgl4 (VGLL4) (NM_001128221) Human Tagged ORF Clone Lentiviral Particle
RC225235L4V

USD 820.00

6 Weeks

Lenti ORF particles, VGLL4 (mGFP-tagged) - Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Vgl4 (VGLL4) (NM_001128220) Human Tagged ORF Clone
RC225242

USD 420.00

3 Weeks

VGLL4 (Myc-DDK-tagged)-Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Vgl4 (VGLL4) (NM_001128220) Human Tagged ORF Clone
RC225242L3

USD 620.00

3 Weeks

Lenti-ORF clone of VGLL4 (Myc-DDK-tagged)-Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Vgl4 (VGLL4) (NM_001128220) Human Tagged ORF Clone Lentiviral Particle
RC225242L3V

USD 820.00

6 Weeks

Lenti ORF particles, VGLL4 (Myc-DDK-tagged)-Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Vgl4 (VGLL4) (NM_001128220) Human Tagged ORF Clone
RC225242L4

USD 620.00

3 Weeks

Lenti-ORF clone of VGLL4 (mGFP-tagged)-Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Vgl4 (VGLL4) (NM_001128219) Human Tagged ORF Clone
RC225405L3

USD 620.00

3 Weeks

Lenti ORF clone of Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Vgl4 (VGLL4) (NM_001128219) Human Tagged ORF Clone Lentiviral Particle
RC225405L3V

USD 820.00

5 Weeks

Lenti ORF particles, VGLL4 (Myc-DDK tagged) - Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Vgl4 (VGLL4) (NM_001128219) Human Tagged ORF Clone
RC225405L4

USD 620.00

3 Weeks

Lenti ORF clone of Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Vgl4 (VGLL4) (NM_001128219) Human Tagged ORF Clone Lentiviral Particle
RC225405L4V

USD 820.00

7 Weeks

Lenti ORF particles, VGLL4 (mGFP-tagged) - Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Vgl4 (VGLL4) (NM_001284391) Human Tagged ORF Clone
RC236754

USD 420.00

2 Weeks

VGLL4 (myc-DDK-tagged) - Human vestigial-like family member 4 (VGLL4), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Vgl4 (VGLL4) (NM_001284390) Human Tagged ORF Clone
RC237257

USD 420.00

2 Weeks

VGLL4 (myc-DDK-tagged) - Human vestigial-like family member 4 (VGLL4), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Vgl4 (VGLL4) (NM_001128221) Human Tagged ORF Clone
RG225235

USD 460.00

3 Weeks

VGLL4 (GFP-tagged) - Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Vgl4 (VGLL4) (NM_001128220) Human Tagged ORF Clone
RG225242

USD 460.00

4 Weeks

VGLL4 (GFP-tagged) - Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Vgl4 (VGLL4) (NM_001128219) Human Tagged ORF Clone
RG225405

USD 460.00

3 Weeks

VGLL4 (GFP-tagged) - Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Vgl4 (VGLL4) (NM_001128219) Human Over-expression Lysate
LY426931

USD 396.00

In Stock

Transient overexpression lysate of vestigial like 4 (Drosophila) (VGLL4), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Vgl4 (VGLL4) (NM_001128219) Human Tagged ORF Clone
RC225405L2

USD 620.00

3 Weeks

Lenti ORF clone of Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Vgl4 (VGLL4) (NM_001128219) Human Untagged Clone
SC322956

USD 660.00

In Stock

VGLL4 (untagged)-Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Vgl4 (VGLL4) (NM_014667) Human Over-expression Lysate
LY415121

USD 396.00

5 Days

Transient overexpression lysate of vestigial like 4 (Drosophila) (VGLL4), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Vgl4 (VGLL4) (NM_014667) Human Untagged Clone
SC121605

USD 660.00

In Stock

VGLL4 (untagged)-Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Vgl4 (VGLL4) (NM_014667) Human Untagged Clone
SC320751

USD 660.00

In Stock

VGLL4 (untagged)-Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Vgl4 (VGLL4) Rabbit Polyclonal Antibody
TA333864

USD 375.00

5 Days

Rabbit Polyclonal Anti-VGLL4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-VGLL4 Antibody is: synthetic peptide directed towards the middle region of Human VGLL4. Synthetic peptide located within the following region: GLEQPLALTKNSLDASRPAGLSPTLTPGERQQNRPSVITCASAGARNCNL
Vgl4 (VGLL4) Rabbit Polyclonal Antibody
TA334088

USD 375.00

5 Days

Rabbit Polyclonal Anti-VGLL4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-VGLL4 Antibody is: synthetic peptide directed towards the middle region of Human VGLL4. Synthetic peptide located within the following region: HSGCAAPGPASYRRPPSAATTCDPVVEEHFRRSLGKNYKEPEPAPNSVSI
Vgl4 (VGLL4) (NM_014667) Human Over-expression Lysate
LC415121

USD 121.00

2 Weeks

VGLL4 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Vgl4 (VGLL4) (NM_001128219) Human Over-expression Lysate
LC426931

USD 121.00

2 Weeks

VGLL4 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Vgl4 (VGLL4) (NM_001128221) Human Over-expression Lysate
LC426933

USD 121.00

2 Weeks

VGLL4 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Vgl4 (VGLL4) (NM_001128221) Human Over-expression Lysate
LY426933

USD 396.00

5 Days

Transient overexpression lysate of vestigial like 4 (Drosophila) (VGLL4), transcript variant 4

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Vgl4 (VGLL4) (NM_014667) Human Mass Spec Standard
PH300886

USD 2,055.00

3 Weeks

VGLL4 MS Standard C13 and N15-labeled recombinant protein (NP_055482)

Tag C-Myc/DDK
Expression Host HEK293
Vgl4 (VGLL4) (NM_001128221) Human Mass Spec Standard
PH325235

USD 2,055.00

3 Weeks

VGLL4 MS Standard C13 and N15-labeled recombinant protein (NP_001121693)

Tag C-Myc/DDK
Expression Host HEK293
Vgl4 (VGLL4) (NM_001128219) Human Mass Spec Standard
PH325405

USD 2,055.00

3 Weeks

VGLL4 MS Standard C13 and N15-labeled recombinant protein (NP_001121691)

Tag C-Myc/DDK
Expression Host HEK293
Vgl4 (VGLL4) (NM_001284391) Human Tagged ORF Clone
RG236754

USD 460.00

2 Weeks

VGLL4 (GFP-tagged) - Human vestigial-like family member 4 (VGLL4), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Vgl4 (VGLL4) (NM_001284390) Human Tagged ORF Clone
RG237257

USD 460.00

2 Weeks

VGLL4 (GFP-tagged) - Human vestigial-like family member 4 (VGLL4), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Vgl4 (VGLL4) (NM_001128221) Human Untagged Clone
SC322892

USD 420.00

3 Weeks

VGLL4 (untagged)-Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 4

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Vgl4 (VGLL4) (NM_001128220) Human Untagged Clone
SC322897

USD 420.00

4 Weeks

VGLL4 (untagged)-Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 3

Vector pCMV6 series
Tag Tag Free
Vgl4 (VGLL4) (NM_001284391) Human Untagged Clone
SC334648

USD 477.00

2 Weeks

VGLL4 (untagged) - Human vestigial-like family member 4 (VGLL4), transcript variant 6

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Vgl4 (VGLL4) (NM_001284390) Human Untagged Clone
SC335151

USD 477.00

2 Weeks

VGLL4 (untagged) - Human vestigial-like family member 4 (VGLL4), transcript variant 5

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin