VGLL4 (Myc-DDK-tagged)-Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
VGLL4 (Myc-DDK-tagged)-Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
VGLL4 (Myc-DDK-tagged)-Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
VGLL4 (Myc-DDK-tagged)-Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human vestigial like 4 (Drosophila) (VGLL4), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
3 Weeks
Lenti ORF particles, VGLL4 (Myc-DDK tagged) - Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, VGLL4 (mGFP-tagged) - Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
VGLL4 (GFP-tagged) - Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, VGLL4 (Myc-DDK tagged) - Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, VGLL4 (mGFP-tagged) - Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 4, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, VGLL4 (Myc-DDK tagged) - Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 4, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, VGLL4 (mGFP-tagged) - Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
VGLL4 (Myc-DDK-tagged)-Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of VGLL4 (Myc-DDK-tagged)-Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, VGLL4 (Myc-DDK-tagged)-Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of VGLL4 (mGFP-tagged)-Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, VGLL4 (mGFP-tagged)-Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, VGLL4 (Myc-DDK tagged) - Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, VGLL4 (mGFP-tagged) - Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
VGLL4 (myc-DDK-tagged) - Human vestigial-like family member 4 (VGLL4), transcript variant 6
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
VGLL4 (myc-DDK-tagged) - Human vestigial-like family member 4 (VGLL4), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
VGLL4 (GFP-tagged) - Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
VGLL4 (GFP-tagged) - Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
VGLL4 (GFP-tagged) - Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of vestigial like 4 (Drosophila) (VGLL4), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
VGLL4 (untagged)-Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 1
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of vestigial like 4 (Drosophila) (VGLL4), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
VGLL4 (untagged)-Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 2
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
VGLL4 (untagged)-Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 2
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-VGLL4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-VGLL4 Antibody is: synthetic peptide directed towards the middle region of Human VGLL4. Synthetic peptide located within the following region: GLEQPLALTKNSLDASRPAGLSPTLTPGERQQNRPSVITCASAGARNCNL |
Rabbit Polyclonal Anti-VGLL4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-VGLL4 Antibody is: synthetic peptide directed towards the middle region of Human VGLL4. Synthetic peptide located within the following region: HSGCAAPGPASYRRPPSAATTCDPVVEEHFRRSLGKNYKEPEPAPNSVSI |
VGLL4 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
VGLL4 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
VGLL4 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of vestigial like 4 (Drosophila) (VGLL4), transcript variant 4
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
VGLL4 MS Standard C13 and N15-labeled recombinant protein (NP_055482)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
VGLL4 MS Standard C13 and N15-labeled recombinant protein (NP_001121693)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
VGLL4 MS Standard C13 and N15-labeled recombinant protein (NP_001121691)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
VGLL4 (GFP-tagged) - Human vestigial-like family member 4 (VGLL4), transcript variant 6
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
VGLL4 (GFP-tagged) - Human vestigial-like family member 4 (VGLL4), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
VGLL4 (untagged)-Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 4
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
VGLL4 (untagged)-Human vestigial like 4 (Drosophila) (VGLL4), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
VGLL4 (untagged) - Human vestigial-like family member 4 (VGLL4), transcript variant 6
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
VGLL4 (untagged) - Human vestigial-like family member 4 (VGLL4), transcript variant 5
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |