Products

View as table Download

ZNF200 (Myc-DDK-tagged)-Human zinc finger protein 200 (ZNF200), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

ZNF200 (Myc-DDK-tagged)-Human zinc finger protein 200 (ZNF200), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

ZNF200 (Myc-DDK-tagged)-Human zinc finger protein 200 (ZNF200), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

ZNF200 (Myc-DDK-tagged)-Human zinc finger protein 200 (ZNF200), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

ZNF200 (Myc-DDK-tagged)-Human zinc finger protein 200 (ZNF200), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

ZNF200 (Myc-DDK-tagged)-Human zinc finger protein 200 (ZNF200), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

ZNF200 (GFP-tagged) - Human zinc finger protein 200 (ZNF200), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ZNF200 (GFP-tagged) - Human zinc finger protein 200 (ZNF200), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human zinc finger protein 200 (ZNF200), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ZNF200 (Myc-DDK tagged) - Human zinc finger protein 200 (ZNF200), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human zinc finger protein 200 (ZNF200), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human zinc finger protein 200 (ZNF200), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ZNF200 (Myc-DDK tagged) - Human zinc finger protein 200 (ZNF200), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human zinc finger protein 200 (ZNF200), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human zinc finger protein 200 (ZNF200), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ZNF200 (Myc-DDK tagged) - Human zinc finger protein 200 (ZNF200), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human zinc finger protein 200 (ZNF200), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of ZNF200 (Myc-DDK-tagged)-Human zinc finger protein 200 (ZNF200), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ZNF200 (Myc-DDK-tagged)-Human zinc finger protein 200 (ZNF200), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of ZNF200 (mGFP-tagged)-Human zinc finger protein 200 (ZNF200), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of ZNF200 (Myc-DDK-tagged)-Human zinc finger protein 200 (ZNF200), transcript variant 5

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ZNF200 (Myc-DDK-tagged)-Human zinc finger protein 200 (ZNF200), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of ZNF200 (mGFP-tagged)-Human zinc finger protein 200 (ZNF200), transcript variant 5

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of ZNF200 (Myc-DDK-tagged)-Human zinc finger protein 200 (ZNF200), transcript variant 6

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ZNF200 (Myc-DDK-tagged)-Human zinc finger protein 200 (ZNF200), transcript variant 6, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of ZNF200 (mGFP-tagged)-Human zinc finger protein 200 (ZNF200), transcript variant 6

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ZNF200 (GFP-tagged) - Human zinc finger protein 200 (ZNF200), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ZNF200 (GFP-tagged) - Human zinc finger protein 200 (ZNF200), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ZNF200 (GFP-tagged) - Human zinc finger protein 200 (ZNF200), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ZNF200 (GFP-tagged) - Human zinc finger protein 200 (ZNF200), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Recombinant protein of human zinc finger protein 200 (ZNF200), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli

ZNF200 (untagged)-Human zinc finger protein 200 (ZNF200), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Purified recombinant protein of Human zinc finger protein 200 (ZNF200), transcript variant 2, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli

Rabbit Polyclonal Anti-ZNF200 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF200 antibody: synthetic peptide directed towards the middle region of human ZNF200. Synthetic peptide located within the following region: SRHEGIHIREKIFKCPECGKTFPKNEEFVLHLQSHEAERPYGCKKCGRRF

Carrier-free (BSA/glycerol-free) ZNF200 mouse monoclonal antibody, clone OTI5F4 (formerly 5F4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ZNF200 mouse monoclonal antibody, clone OTI7C6 (formerly 7C6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ZNF200 mouse monoclonal antibody, clone OTI3B6 (formerly 3B6)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ZNF200 mouse monoclonal antibody, clone OTI1F3 (formerly 1F3)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ZNF200 mouse monoclonal antibody, clone OTI6F10 (formerly 6F10)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ZNF200 mouse monoclonal antibody, clone OTI3D1 (formerly 3D1)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ZNF200 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ZNF200 mouse monoclonal antibody, clone OTI4C4 (formerly 4C4)

Applications WB
Reactivities Human
Conjugation Unconjugated

ZNF200 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB