TECR (Myc-DDK-tagged)-Human trans-2,3-enoyl-CoA reductase (TECR), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TECR (Myc-DDK-tagged)-Human trans-2,3-enoyl-CoA reductase (TECR), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TECR (GFP-tagged) - Human trans-2,3-enoyl-CoA reductase (TECR), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human trans-2,3-enoyl-CoA reductase (TECR), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, TECR (Myc-DDK tagged) - Human trans-2,3-enoyl-CoA reductase (TECR), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human trans-2,3-enoyl-CoA reductase (TECR), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, TECR (mGFP-tagged) - Human trans-2,3-enoyl-CoA reductase (TECR), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-GPSN2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GPSN2 antibody: synthetic peptide directed towards the middle region of human GPSN2. Synthetic peptide located within the following region: PFIYGHKYDFTSSRHTVVHLACICHSFHYIKRLLETLFVHRFSHGTMPLR |
Rabbit Polyclonal Anti-GPSN2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GPSN2 antibody: synthetic peptide directed towards the C terminal of human GPSN2. Synthetic peptide located within the following region: LRPAGSKTRKIPYPTKNPFTWLFLLVSCPNYTYEVGSWIGFAIMTQCLPV |
GPSN2 (TECR) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal regio (between 274-304) of human TECR / GPSN2. |
TECR (untagged)-Human trans-2,3-enoyl-CoA reductase (TECR), transcript variant 1
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of trans-2,3-enoyl-CoA reductase (TECR)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
TECR HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression of TECR (NM_138501) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TECR (NM_138501) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TECR (NM_138501) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack