Products

cDNA Clones (29)
Proteins (23)
Antibodies (2)
Jump to Filters
View as table Download
GAA (NM_000152) Human Tagged ORF Clone
RC215796

USD 420.00

In Stock

GAA (Myc-DDK-tagged)-Human glucosidase, alpha, acid (GAA), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GAA (NM_001079803) Human Tagged ORF Clone
RC215840

USD 420.00

In Stock

GAA (Myc-DDK-tagged)-Human glucosidase, alpha, acid (GAA), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GAA (NM_000152) Human Untagged Clone
SC125512

USD 310.00

In Stock

GAA (untagged)-Human glucosidase, alpha, acid (GAA), transcript variant 1

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
GAA (NM_001079804) Human Tagged ORF Clone
RC208033

USD 420.00

In Stock

GAA (Myc-DDK-tagged)-Human glucosidase, alpha, acid (GAA), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GAA (NM_001079804) Human Tagged ORF Clone Lentiviral Particle
RC208033L1V

USD 820.00

3 Weeks

Lenti ORF particles, GAA (Myc-DDK tagged) - Human glucosidase, alpha; acid (GAA), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
GAA (NM_001079804) Human Tagged ORF Clone Lentiviral Particle
RC208033L2V

USD 820.00

6 Weeks

Lenti ORF particles, GAA (mGFP-tagged) - Human glucosidase, alpha; acid (GAA), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
GAA (NM_000152) Human Tagged ORF Clone Lentiviral Particle
RC215796L1V

USD 820.00

3 Weeks

Lenti ORF particles, GAA (Myc-DDK tagged) - Human glucosidase, alpha; acid (GAA), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
GAA (NM_000152) Human Tagged ORF Clone Lentiviral Particle
RC215796L2V

USD 820.00

6 Weeks

Lenti ORF particles, GAA (mGFP-tagged) - Human glucosidase, alpha; acid (GAA), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
GAA (NM_000152) Human Tagged ORF Clone
RG215796

USD 460.00

In Stock

GAA (GFP-tagged) - Human glucosidase, alpha; acid (GAA), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GAA (NM_001079803) Human Tagged ORF Clone
RG215840

USD 460.00

In Stock

GAA (GFP-tagged) - Human glucosidase, alpha; acid (GAA), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GAA (NM_000152) Human Tagged ORF Clone Lentiviral Particle
RC215796L3V

USD 820.00

3 Weeks

Lenti ORF particles, GAA (Myc-DDK tagged) - Human glucosidase, alpha; acid (GAA), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GAA (NM_001079804) Human Tagged ORF Clone
RC208033L3

USD 620.00

3 Weeks

Lenti ORF clone of Human glucosidase, alpha; acid (GAA), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GAA (NM_001079804) Human Tagged ORF Clone Lentiviral Particle
RC208033L3V

USD 820.00

5 Weeks

Lenti ORF particles, GAA (Myc-DDK tagged) - Human glucosidase, alpha; acid (GAA), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GAA (NM_001079804) Human Tagged ORF Clone
RC208033L4

USD 620.00

3 Weeks

Lenti ORF clone of Human glucosidase, alpha; acid (GAA), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GAA (NM_001079804) Human Tagged ORF Clone Lentiviral Particle
RC208033L4V

USD 820.00

7 Weeks

Lenti ORF particles, GAA (mGFP-tagged) - Human glucosidase, alpha; acid (GAA), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GAA (NM_000152) Human Tagged ORF Clone
RC215796L3

USD 620.00

3 Weeks

Lenti ORF clone of Human glucosidase, alpha; acid (GAA), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GAA (NM_000152) Human Tagged ORF Clone
RC215796L4

USD 620.00

3 Weeks

Lenti ORF clone of Human glucosidase, alpha; acid (GAA), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GAA (NM_000152) Human Tagged ORF Clone Lentiviral Particle
RC215796L4V

USD 820.00

7 Weeks

Lenti ORF particles, GAA (mGFP-tagged) - Human glucosidase, alpha; acid (GAA), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GAA (NM_001079803) Human Tagged ORF Clone
RC215840L3

USD 620.00

3 Weeks

Lenti ORF clone of Human glucosidase, alpha; acid (GAA), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GAA (NM_001079803) Human Tagged ORF Clone Lentiviral Particle
RC215840L3V

USD 820.00

6 Weeks

Lenti ORF particles, GAA (Myc-DDK tagged) - Human glucosidase, alpha; acid (GAA), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GAA (NM_001079803) Human Tagged ORF Clone
RC215840L4

USD 620.00

3 Weeks

Lenti ORF clone of Human glucosidase, alpha; acid (GAA), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GAA (NM_001079803) Human Tagged ORF Clone Lentiviral Particle
RC215840L4V

USD 820.00

6 Weeks

Lenti ORF particles, GAA (mGFP-tagged) - Human glucosidase, alpha; acid (GAA), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GAA (NM_001079804) Human Tagged ORF Clone
RG208033

USD 460.00

3 Weeks

GAA (GFP-tagged) - Human glucosidase, alpha; acid (GAA), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GAA (NM_001079804) Human Tagged ORF Clone
RC208033L1

USD 768.00

In Stock

Lenti ORF clone of Human glucosidase, alpha; acid (GAA), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
GAA (NM_000152) Human Tagged ORF Clone
RC215796L1

USD 768.00

In Stock

Lenti ORF clone of Human glucosidase, alpha; acid (GAA), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
GAA (NM_000152) Human Over-expression Lysate
LY400052

USD 396.00

In Stock

Transient overexpression lysate of glucosidase, alpha; acid (GAA), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GAA Rabbit Polyclonal Antibody
TA334653

USD 375.00

5 Days

Rabbit Polyclonal Anti-GAA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GAA antibody: synthetic peptide directed towards the N terminal of human GAA. Synthetic peptide located within the following region: FGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPL
GAA (NM_001079804) Human Tagged ORF Clone
RC208033L2

USD 620.00

3 Weeks

Lenti ORF clone of Human glucosidase, alpha; acid (GAA), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
GAA (NM_000152) Human Tagged ORF Clone
RC215796L2

USD 620.00

3 Weeks

Lenti ORF clone of Human glucosidase, alpha; acid (GAA), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
GAA (N-term) Rabbit Polyclonal Antibody
AP51752PU-N

USD 450.00

2 Weeks

GAA (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen conjugated synthetic peptide between 173-203 amino acids from the N-terminal region of Human Alpha-glucosidase
GAA (NM_001079804) Human Untagged Clone
SC324087

USD 760.00

In Stock

GAA (untagged)-Human glucosidase, alpha, acid (GAA), transcript variant 3

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
GAA (NM_001079803) Human Recombinant Protein
TP701073

USD 748.00

In Stock

Purified recombinant protein of Human glucosidase, alpha, acid (GAA), with N-terminal His tag, secretory expressed in HEK293 cells, 20ug

Tag N-His
Expression Host HEK293
GAA (NM_000152) Human Over-expression Lysate
LC400052

USD 121.00

2 Weeks

GAA HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
GAA (NM_001079803) Human Over-expression Lysate
LC421540

USD 187.00

2 Weeks

GAA HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GAA (NM_001079804) Human Over-expression Lysate
LC421541

USD 121.00

2 Weeks

GAA HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GAA (NM_001079804) Human Over-expression Lysate
LC425893

USD 187.00

2 Weeks

GAA HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GAA (NM_001079803) Human Over-expression Lysate
LY421540

USD 605.00

5 Days

Transient overexpression lysate of glucosidase, alpha; acid (GAA), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GAA (NM_001079804) Human Over-expression Lysate
LY421541

USD 396.00

5 Days

Transient overexpression lysate of glucosidase, alpha; acid (GAA), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY421541 is the same product as LY425893.
GAA (NM_001079804) Human Over-expression Lysate
LY425893

USD 605.00

5 Days

Transient overexpression lysate of glucosidase, alpha; acid (GAA), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GAA (NM_001079804) Human Mass Spec Standard
PH308033

USD 2,055.00

3 Weeks

GAA MS Standard C13 and N15-labeled recombinant protein (NP_001073272)

Tag C-Myc/DDK
Expression Host HEK293
GAA (NM_000152) Human Mass Spec Standard
PH315796

USD 2,055.00

3 Weeks

GAA MS Standard C13 and N15-labeled recombinant protein (NP_000143)

Tag C-Myc/DDK
Expression Host HEK293
GAA (NM_001079803) Human Mass Spec Standard
PH315840

USD 2,055.00

3 Weeks

GAA MS Standard C13 and N15-labeled recombinant protein (NP_001073271)

Tag C-Myc/DDK
Expression Host HEK293
GAA (NM_001079803) Human Untagged Clone
SC315853

USD 760.00

3 Weeks

GAA (untagged)-Human glucosidase, alpha, acid (GAA), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
GAA ICC Control Block
TB408033

USD 1,070.00

4 Weeks

Transient overexpression of GAA (NM_001079804) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GAA ICC Control Block
TB415796

USD 1,070.00

4 Weeks

Transient overexpression of GAA (NM_000152) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GAA ICC Control Block
TB415840

USD 1,070.00

4 Weeks

Transient overexpression of GAA (NM_001079803) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GAA Cytosection
TS408033

USD 225.00

4 Weeks

Transient overexpression of GAA (NM_001079804) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GAA Cytosection
TS408033P5

USD 889.00

4 Weeks

Transient overexpression of GAA (NM_001079804) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack