Products

cDNA Clones (12)
Proteins (8)
Antibodies (4)
Jump to Filters
View as table Download
LCAT (NM_000229) Human Tagged ORF Clone
RC203763

USD 420.00

In Stock

LCAT (Myc-DDK-tagged)-Human lecithin-cholesterol acyltransferase (LCAT)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
LCAT (NM_000229) Human Tagged ORF Clone Lentiviral Particle
RC203763L1V

USD 820.00

3 Weeks

Lenti ORF particles, LCAT (Myc-DDK tagged) - Human lecithin-cholesterol acyltransferase (LCAT), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
LCAT (NM_000229) Human Tagged ORF Clone Lentiviral Particle
RC203763L2V

USD 820.00

6 Weeks

Lenti ORF particles, LCAT (mGFP-tagged) - Human lecithin-cholesterol acyltransferase (LCAT), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
LCAT (NM_000229) Human Tagged ORF Clone
RG203763

USD 460.00

In Stock

LCAT (GFP-tagged) - Human lecithin-cholesterol acyltransferase (LCAT)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
LCAT (NM_000229) Human Untagged Clone
SC120019

USD 310.00

In Stock

LCAT (untagged)-Human lecithin-cholesterol acyltransferase (LCAT)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
LCAT (NM_000229) Human Tagged ORF Clone
RC203763L3

USD 620.00

3 Weeks

Lenti ORF clone of Human lecithin-cholesterol acyltransferase (LCAT), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LCAT (NM_000229) Human Tagged ORF Clone Lentiviral Particle
RC203763L3V

USD 820.00

5 Weeks

Lenti ORF particles, LCAT (Myc-DDK tagged) - Human lecithin-cholesterol acyltransferase (LCAT), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LCAT (NM_000229) Human Tagged ORF Clone Lentiviral Particle
RC203763L4V

USD 820.00

3 Weeks

Lenti ORF particles, LCAT (mGFP-tagged) - Human lecithin-cholesterol acyltransferase (LCAT), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LCAT Rabbit Polyclonal Antibody
TA346169

USD 475.00

5 Days

Rabbit Polyclonal Anti-LCAT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LCAT antibody: synthetic peptide directed towards the C terminal of human LCAT. Synthetic peptide located within the following region: GVLYEDGDDTVATRSTELCGLWQGRQPQPVHLLPLHGIQHLNMVFSNLTL
LCAT (NM_000229) Human Over-expression Lysate
LY400086

USD 396.00

5 Days

Transient overexpression lysate of lecithin-cholesterol acyltransferase (LCAT)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LCAT (NM_000229) Human Tagged ORF Clone
RC203763L1

USD 768.00

In Stock

Lenti ORF clone of Human lecithin-cholesterol acyltransferase (LCAT), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
LCAT (NM_000229) Human Untagged Clone
SC323736

USD 310.00

In Stock

LCAT (untagged)-Human lecithin-cholesterol acyltransferase (LCAT)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
LCAT Rabbit Polyclonal Antibody
TA325121

USD 450.00

2 Weeks

Rabbit polyclonal LCAT Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This LCAT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 285-313 amino acids from the Central region of human LCAT.
LCAT Rabbit Polyclonal Antibody
TA346168

USD 410.00

5 Days

Rabbit Polyclonal Anti-LCAT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LCAT antibody: synthetic peptide directed towards the N terminal of human LCAT. Synthetic peptide located within the following region: MGPPGSPWQWVTLLLGLLLPPAAPFWLLNVLFPPHTTPKAELSNHTRPVI
LCAT (NM_000229) Human Tagged ORF Clone
RC203763L2

USD 620.00

3 Weeks

Lenti ORF clone of Human lecithin-cholesterol acyltransferase (LCAT), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
LCAT (NM_000229) Human Recombinant Protein
TP760551

USD 215.00

In Stock

Purified recombinant protein of Human lecithin-cholesterol acyltransferase (LCAT), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
LCAT (NM_000229) Human Over-expression Lysate
LC400086

USD 121.00

In Stock

LCAT HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
LCAT Rabbit Polyclonal Antibody
TA336717

USD 424.00

5 Days

Rabbit Polyclonal LCAT Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Carboxyl-terminal histidine-tagged mouse recombinant LCAT purified from the medium of CHO cells overexpressing mouse LCAT cDNA. [UniProt# P16301]
LCAT (25-440, His-tag) Human Protein
AR50723PU-N

USD 845.00

2 Weeks

LCAT (25-440, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
LCAT (25-440, His-tag) Human Protein
AR50723PU-S

USD 330.00

2 Weeks

LCAT (25-440, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
LCAT ICC Control Block
TB403763

USD 1,070.00

4 Weeks

Transient overexpression of LCAT (NM_000229) in HEK293T cells paraffin embedded controls for ICC/IHC staining

LCAT Cytosection
TS403763

USD 225.00

4 Weeks

Transient overexpression of LCAT (NM_000229) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

LCAT Cytosection
TS403763P5

USD 889.00

4 Weeks

Transient overexpression of LCAT (NM_000229) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack