SLC6A3 (Myc-DDK-tagged)-Human solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 (SLC6A3)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
SLC6A3 (Myc-DDK-tagged)-Human solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 (SLC6A3)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SLC6A3 (untagged)-Human solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 (SLC6A3)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
SLC6A3 (GFP-tagged) - Human solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 (SLC6A3)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 880.00
3 Weeks
Lenti ORF particles, SLC6A3 (Myc-DDK tagged) - Human solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 (SLC6A3), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 880.00
6 Weeks
Lenti ORF particles, SLC6A3 (mGFP-tagged) - Human solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 (SLC6A3), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 880.00
5 Weeks
Lenti ORF particles, SLC6A3 (Myc-DDK tagged) - Human solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 (SLC6A3), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 (SLC6A3), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 880.00
3 Weeks
Lenti ORF particles, SLC6A3 (mGFP-tagged) - Human solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 (SLC6A3), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Goat Anti-SLC6A3 / DAT Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QLTSSTLTNPRQSP, from the internal region (near N Terminus) of the protein sequence according to NP_001035.1. |
USD 424.00
2 Weeks
Mouse Monoclonal SLC6A3/DAT1 Antibody (mAb16)
Applications | IHC, WB |
Reactivities | Mouse, Rat (Does not react with: Human) |
Conjugation | Unconjugated |
Lenti ORF clone of Human solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 (SLC6A3), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 (SLC6A3), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Anti-Dopamine Transporter, C-Terminus, Human Antibody
Applications | WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to amino acid residues from the intracellular C-terminal region conjugated to KLH |
Rabbit Anti-Dopamine Transporter, Extracellular Loop 2, Human Antibody
Applications | WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to amino acid residues from the extracellular loop 2 region conjugated to KLH |
Rabbit Polyclonal Anti-SLC6A3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SLC6A3 Antibody: synthetic peptide directed towards the N terminal of human SLC6A3. Synthetic peptide located within the following region: HCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSH |
Rabbit Polyclonal Anti-SLC6A3 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLC6A3 |
Transient overexpression of SLC6A3 (NM_001044) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SLC6A3 (NM_001044) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SLC6A3 (NM_001044) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack