SIGLEC9 (C-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 385-415 amino acids from the C-terminal region of human SIGLEC9. |
SIGLEC9 (C-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 385-415 amino acids from the C-terminal region of human SIGLEC9. |
Rabbit polyclonal antibody to SIGLEC9 (sialic acid binding Ig-like lectin 9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 273 of SIGLEC9 (Uniprot ID#Q9Y336) |
Rabbit Polyclonal Anti-SIGLEC9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SIGLEC9 antibody: synthetic peptide directed towards the C terminal of human SIGLEC9. Synthetic peptide located within the following region: PWVHLRDAAEFTCRAQNPLGSQQVYLNVSLQSKATSGVTQGVVGGAGATA |
Carrier-free (BSA/glycerol-free) SIGLEC9 mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SIGLEC9 mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)
Applications | IHC, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SIGLEC9 mouse monoclonal antibody, clone OTI8F7 (formerly 8F7)
Applications | IHC, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SIGLEC9 mouse monoclonal antibody, clone OTI6D8 (formerly 6D8)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SIGLEC9 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SIGLEC9 |
Anti-SIGLEC9 mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-SIGLEC9 mouse monoclonal antibody, clone OTI3G8 (formerly 3G8), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
Anti-SIGLEC9 mouse monoclonal antibody, clone OTI3G8 (formerly 3G8), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
Anti-SIGLEC9 mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
SIGLEC9 mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)
Applications | IHC, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
SIGLEC9 mouse monoclonal antibody, clone OTI1D9 (formerly 1D9), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Biotin |
SIGLEC9 mouse monoclonal antibody, clone OTI1D9 (formerly 1D9), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | HRP |
SIGLEC9 mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)
Applications | IHC, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
SIGLEC9 mouse monoclonal antibody, clone OTI8F7 (formerly 8F7)
Applications | IHC, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
SIGLEC9 mouse monoclonal antibody, clone OTI8F7 (formerly 8F7), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Biotin |
SIGLEC9 mouse monoclonal antibody, clone OTI8F7 (formerly 8F7), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | HRP |
SIGLEC9 mouse monoclonal antibody, clone OTI8F7 (formerly 8F7)
Applications | IHC, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
SIGLEC9 mouse monoclonal antibody, clone OTI6D8 (formerly 6D8)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
SIGLEC9 mouse monoclonal antibody, clone OTI6D8 (formerly 6D8), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Biotin |
SIGLEC9 mouse monoclonal antibody, clone OTI6D8 (formerly 6D8), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | HRP |
SIGLEC9 mouse monoclonal antibody, clone OTI6D8 (formerly 6D8)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |