Products

Primary Antibodies (24)
View as table Download

SIGLEC9 (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 385-415 amino acids from the C-terminal region of human SIGLEC9.

Rabbit polyclonal antibody to SIGLEC9 (sialic acid binding Ig-like lectin 9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 273 of SIGLEC9 (Uniprot ID#Q9Y336)

Rabbit Polyclonal Anti-SIGLEC9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIGLEC9 antibody: synthetic peptide directed towards the C terminal of human SIGLEC9. Synthetic peptide located within the following region: PWVHLRDAAEFTCRAQNPLGSQQVYLNVSLQSKATSGVTQGVVGGAGATA

Carrier-free (BSA/glycerol-free) SIGLEC9 mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SIGLEC9 mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)

Applications IHC, WB
Reactivities Human, Monkey, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SIGLEC9 mouse monoclonal antibody, clone OTI8F7 (formerly 8F7)

Applications IHC, WB
Reactivities Human, Monkey, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SIGLEC9 mouse monoclonal antibody, clone OTI6D8 (formerly 6D8)

Applications IF, IHC, WB
Reactivities Human, Monkey, Dog
Conjugation Unconjugated

Rabbit Polyclonal Anti-SIGLEC9 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SIGLEC9

Anti-SIGLEC9 mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)

Applications WB
Reactivities Human
Conjugation Unconjugated

Anti-SIGLEC9 mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)

Applications WB
Reactivities Human
Conjugation Unconjugated

SIGLEC9 mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)

Applications IHC, WB
Reactivities Human, Monkey, Dog
Conjugation Unconjugated

SIGLEC9 mouse monoclonal antibody, clone OTI1D9 (formerly 1D9), Biotinylated

Applications IHC, WB
Reactivities Human, Monkey, Dog
Conjugation Biotin

SIGLEC9 mouse monoclonal antibody, clone OTI1D9 (formerly 1D9), HRP conjugated

Applications IHC, WB
Reactivities Human, Monkey, Dog
Conjugation HRP

SIGLEC9 mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)

Applications IHC, WB
Reactivities Human, Monkey, Dog
Conjugation Unconjugated

SIGLEC9 mouse monoclonal antibody, clone OTI8F7 (formerly 8F7)

Applications IHC, WB
Reactivities Human, Monkey, Dog
Conjugation Unconjugated

SIGLEC9 mouse monoclonal antibody, clone OTI8F7 (formerly 8F7), Biotinylated

Applications IHC, WB
Reactivities Human, Monkey, Dog
Conjugation Biotin

SIGLEC9 mouse monoclonal antibody, clone OTI8F7 (formerly 8F7), HRP conjugated

Applications IHC, WB
Reactivities Human, Monkey, Dog
Conjugation HRP

SIGLEC9 mouse monoclonal antibody, clone OTI8F7 (formerly 8F7)

Applications IHC, WB
Reactivities Human, Monkey, Dog
Conjugation Unconjugated

SIGLEC9 mouse monoclonal antibody, clone OTI6D8 (formerly 6D8)

Applications IF, IHC, WB
Reactivities Human, Monkey, Dog
Conjugation Unconjugated

SIGLEC9 mouse monoclonal antibody, clone OTI6D8 (formerly 6D8)

Applications IF, IHC, WB
Reactivities Human, Monkey, Dog
Conjugation Unconjugated