Products

cDNA Clones (15)
Proteins (5)
Antibodies (2)
Jump to Filters
View as table Download
ABCC9 (NM_005691) Human Tagged ORF Clone
RC224378

USD 1,630.00

In Stock

ABCC9 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family C (CFTR/MRP), member 9 (ABCC9), transcript variant SUR2A

Vector pCMV6-AC-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ABCC9 (NM_020297) Human Tagged ORF Clone
RC223539

USD 1,630.00

7 Weeks

ABCC9 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family C (CFTR/MRP), member 9 (ABCC9), transcript variant SUR2B

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ABCC9 (NM_020297) Human Tagged ORF Clone
RC223539L3

USD 1,830.00

10 Weeks

Lenti-ORF clone of ABCC9 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family C (CFTR/MRP), member 9 (ABCC9), transcript variant SUR2B

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCC9 (NM_020297) Human Tagged ORF Clone Lentiviral Particle
RC223539L3V

USD 2,030.00

13 Weeks

Lenti ORF particles, ABCC9 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family C (CFTR/MRP), member 9 (ABCC9), transcript variant SUR2B, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCC9 (NM_020297) Human Tagged ORF Clone
RC223539L4

USD 1,830.00

10 Weeks

Lenti-ORF clone of ABCC9 (mGFP-tagged)-Human ATP-binding cassette, sub-family C (CFTR/MRP), member 9 (ABCC9), transcript variant SUR2B

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCC9 (NM_020297) Human Tagged ORF Clone Lentiviral Particle
RC223539L4V

USD 2,030.00

13 Weeks

Lenti ORF particles, ABCC9 (mGFP-tagged)-Human ATP-binding cassette, sub-family C (CFTR/MRP), member 9 (ABCC9), transcript variant SUR2B, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCC9 (NM_005691) Human Tagged ORF Clone
RC224378L3

USD 1,830.00

3 Weeks

Lenti-ORF clone of ABCC9 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family C (CFTR/MRP), member 9 (ABCC9), transcript variant SUR2A

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCC9 (NM_005691) Human Tagged ORF Clone Lentiviral Particle
RC224378L3V

USD 2,030.00

6 Weeks

Lenti ORF particles, ABCC9 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family C (CFTR/MRP), member 9 (ABCC9), transcript variant SUR2A, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCC9 (NM_005691) Human Tagged ORF Clone
RC224378L4

USD 1,830.00

3 Weeks

Lenti-ORF clone of ABCC9 (mGFP-tagged)-Human ATP-binding cassette, sub-family C (CFTR/MRP), member 9 (ABCC9), transcript variant SUR2A

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCC9 (NM_005691) Human Tagged ORF Clone Lentiviral Particle
RC224378L4V

USD 2,030.00

6 Weeks

Lenti ORF particles, ABCC9 (mGFP-tagged)-Human ATP-binding cassette, sub-family C (CFTR/MRP), member 9 (ABCC9), transcript variant SUR2A, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCC9 (NM_020297) Human Tagged ORF Clone
RG223539

USD 1,790.00

7 Weeks

ABCC9 (GFP-tagged) - Human ATP-binding cassette, sub-family C (CFTR/MRP), member 9 (ABCC9), transcript variant SUR2B

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ABCC9 (NM_005691) Human Tagged ORF Clone
RG224378

USD 1,790.00

3 Weeks

ABCC9 (GFP-tagged) - Human ATP-binding cassette, sub-family C (CFTR/MRP), member 9 (ABCC9), transcript variant SUR2A

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ABCC9 (NM_005691) Human Untagged Clone
SC316627

USD 3,140.00

In Stock

ABCC9 (untagged)-Human ATP-binding cassette, sub-family C (CFTR/MRP), member 9 (ABCC9), transcript variant SUR2A

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ABCC9 (NM_020297) Human Untagged Clone
SC304733

USD 3,140.00

5 Days

ABCC9 (untagged)-Human ATP-binding cassette, sub-family C (CFTR/MRP), member 9 (ABCC9), transcript variant SUR2B

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ABCC9 (BC033804) Human Untagged Clone
SC122354

USD 660.00

In Stock

ABCC9 (untagged)-Homo sapiens, similar to ATP-binding cassette, sub-family C, member 9, isoform SUR2B, sulfonylurea receptor 2A, clone MGC:45226 IMAGE:5188093, complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ABCC9 Rabbit Polyclonal Antibody
TA332057

USD 375.00

5 Days

Rabbit Polyclonal Anti-ABCC9 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCC9 Antibody: synthetic peptide directed towards the middle region of human ABCC9. Synthetic peptide located within the following region: AVVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQK
ABCC9 Rabbit Polyclonal Antibody
TA351770

USD 345.00

In Stock

Rabbit Polyclonal Anti-ABCC9 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ABCC9
ABCC9 (NM_020297) ICC Control Block
TB423539

USD 2,280.00

4 Weeks

Transient overexpression of ABCC9 (NM_020297) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ABCC9 (NM_005691) ICC Control Block
TB424378

USD 2,280.00

4 Weeks

Transient overexpression of ABCC9 (NM_005691) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ABCC9 ICC Control Sections
TS423539P5

USD 889.00

4 Weeks

Transient overexpression of ABCC9 (NM_020297) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ABCC9 Cytosection
TS424378

USD 225.00

4 Weeks

Transient overexpression of ABCC9 (NM_005691) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ABCC9 Cytosection
TS424378P5

USD 889.00

4 Weeks

Transient overexpression of ABCC9 (NM_005691) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack