Products

View as table Download

USD 98.00

USD 560.00

In Stock

ADAM15 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, ADAM15 (Myc-DDK tagged) - Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, ADAM15 (mGFP-tagged) - Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

ADAM15 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

ADAM15 (GFP-tagged) - Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ADAM15 (Myc-DDK tagged) - Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ADAM15 (mGFP-tagged) - Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ADAM15 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of ADAM15 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ADAM15 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of ADAM15 (mGFP-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ADAM15 (mGFP-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of ADAM15 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ADAM15 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of ADAM15 (mGFP-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ADAM15 (mGFP-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ADAM15 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of ADAM15 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ADAM15 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of ADAM15 (mGFP-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ADAM15 (mGFP-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ADAM15 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of ADAM15 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 6

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ADAM15 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 6, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of ADAM15 (mGFP-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 6

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ADAM15 (mGFP-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 6, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ADAM15 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of ADAM15 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 5

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ADAM15 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of ADAM15 (mGFP-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 5

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ADAM15 (mGFP-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ADAM15 (Myc-DDK tagged) - Homo sapiens ADAM metallopeptidase domain 15 (ADAM15), transcript variant 9

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

ADAM15 (Myc-DDK tagged) - Homo sapiens ADAM metallopeptidase domain 15 (ADAM15), transcript variant 8

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

ADAM15 (Myc-DDK tagged) - Homo sapiens ADAM metallopeptidase domain 15 (ADAM15), transcript variant 7

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

ADAM15 (GFP-tagged) - Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ADAM15 (GFP-tagged) - Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ADAM15 (GFP-tagged) - Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ADAM15 (GFP-tagged) - Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ADAM15 (GFP-tagged) - Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ADAM15 (GFP-tagged) - Homo sapiens ADAM metallopeptidase domain 15 (ADAM15), transcript variant 9

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ADAM15 (GFP-tagged) - Homo sapiens ADAM metallopeptidase domain 15 (ADAM15), transcript variant 8

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ADAM15 (GFP-tagged) - Homo sapiens ADAM metallopeptidase domain 15 (ADAM15), transcript variant 7

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

ADAM15 (untagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Lenti ORF clone of Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

ADAM15 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal Anti-ADAM15 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ADAM15 antibody: synthetic peptide directed towards the middle region of human ADAM15. Synthetic peptide located within the following region: QPAAPLCLQTANTRGNAFGSCGRNPSGSYVSCTPRDAICGQLQCQTGRTQ

Transient overexpression lysate of ADAM metallopeptidase domain 15 (ADAM15), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB