Products

cDNA Clones (19)
Proteins (11)
Antibodies (4)
Jump to Filters
View as table Download
ADGRE1 (NM_001974) Human Tagged ORF Clone
RC213462

USD 990.00

In Stock

EMR1 (Myc-DDK-tagged)-Human egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ADGRE1 (NM_001974) Human Tagged ORF Clone
RC213462L3

USD 1,190.00

3 Weeks

Lenti ORF clone of Human egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ADGRE1 (NM_001974) Human Tagged ORF Clone Lentiviral Particle
RC213462L3V

USD 1,390.00

6 Weeks

Lenti ORF particles, ADGRE1 (Myc-DDK tagged) - Human egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ADGRE1 (NM_001974) Human Tagged ORF Clone
RC213462L4

USD 1,190.00

3 Weeks

Lenti ORF clone of Human egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ADGRE1 (NM_001974) Human Tagged ORF Clone Lentiviral Particle
RC213462L4V

USD 1,390.00

6 Weeks

Lenti ORF particles, ADGRE1 (mGFP-tagged) - Human egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ADGRE1 (NM_001256255) Human Tagged ORF Clone
RC233097

USD 610.00

4 Weeks

EMR1 (Myc-DDK tagged) - Homo sapiens egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ADGRE1 (NM_001256254) Human Tagged ORF Clone
RC233116

USD 610.00

4 Weeks

EMR1 (Myc-DDK tagged) - Homo sapiens egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ADGRE1 (NM_001256252) Human Tagged ORF Clone
RC233151

USD 750.00

4 Weeks

EMR1 (Myc-DDK tagged) - Homo sapiens egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ADGRE1 (NM_001256253) Human Tagged ORF Clone
RC234932

USD 610.00

5 Weeks

EMR1 (Myc-DDK tagged) - Homo sapiens egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ADGRE1 (NM_001974) Human Tagged ORF Clone
RG213462

USD 1,090.00

3 Weeks

EMR1 (GFP-tagged) - Human egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ADGRE1 (NM_001256255) Human Tagged ORF Clone
RG233097

USD 670.00

4 Weeks

EMR1 (GFP-tagged) - Homo sapiens egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ADGRE1 (NM_001256254) Human Tagged ORF Clone
RG233116

USD 670.00

4 Weeks

EMR1 (GFP-tagged) - Homo sapiens egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ADGRE1 (NM_001256252) Human Tagged ORF Clone
RG233151

USD 830.00

4 Weeks

EMR1 (GFP-tagged) - Homo sapiens egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ADGRE1 (NM_001256253) Human Tagged ORF Clone
RG234932

USD 670.00

5 Weeks

EMR1 (GFP-tagged) - Homo sapiens egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ADGRE1 Rabbit Polyclonal Antibody
TA308395

USD 415.00

2 Weeks

Rabbit Polyclonal antibody to EMR1 (egf-like module containing, mucin-like, hormone receptor-like 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 626 and 886 of EMR1 (Uniprot ID#Q14246)
ADGRE1 (NM_001974) Human Untagged Clone
SC303102

USD 1,800.00

In Stock

EMR1 (untagged)-Human egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ADGRE1 Rabbit Polyclonal Antibody
TA313816

USD 345.00

In Stock

Rabbit polyclonal anti-EMR1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human EMR1.
ADGRE1 Rabbit Polyclonal Antibody
TA338259

USD 375.00

5 Days

Rabbit Polyclonal Anti-EMR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EMR1 antibody is: synthetic peptide directed towards the C-terminal region of Human EMR1. Synthetic peptide located within the following region: GAFIFLIHCLLNGQVREEYKRWITGKTKPSSQSQTSRILLSSMPSASKTG
ADGRE1 Rabbit Polyclonal Antibody
TA340886

USD 425.00

5 Days

Rabbit Polyclonal Anti-EMR1 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen EMR1 / F4/80 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human EMR1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Marmoset (89%); Gibbon (83%).
ADGRE1 (NM_001256252) Human Untagged Clone
SC330384

USD 880.00

4 Weeks

EMR1 (untagged) - Homo sapiens egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1), transcript variant 2

Vector pCMV6 series
Tag Tag Free
ADGRE1 (NM_001256254) Human Untagged Clone
SC330385

USD 750.00

4 Weeks

EMR1 (untagged) - Homo sapiens egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1), transcript variant 4

Vector pCMV6 series
Tag Tag Free
ADGRE1 (NM_001256255) Human Untagged Clone
SC330386

USD 720.00

4 Weeks

EMR1 (untagged) - Homo sapiens egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1), transcript variant 5

Vector pCMV6 series
Tag Tag Free
ADGRE1 (NM_001256253) Human Untagged Clone
SC332325

USD 830.00

5 Weeks

EMR1 (untagged) - Homo sapiens egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1), transcript variant 3

Vector pCMV6 series
Tag Tag Free
ADGRE1 ICC Control Block
TB413462

USD 1,640.00

4 Weeks

Transient overexpression of ADGRE1 (NM_001974) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ADGRE1 ICC Control Block
TB433097

USD 1,260.00

4 Weeks

Transient overexpression of ADGRE1 (NM_001256255) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ADGRE1 ICC Control Block
TB433116

USD 1,260.00

4 Weeks

Transient overexpression of ADGRE1 (NM_001256254) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ADGRE1 ICC Control Block
TB433151

USD 1,400.00

4 Weeks

Transient overexpression of ADGRE1 (NM_001256252) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ADGRE1 ICC Control Block
TB434932

USD 1,260.00

4 Weeks

Transient overexpression of ADGRE1 (NM_001256253) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ADGRE1 Cytosection
TS413462

USD 225.00

4 Weeks

Transient overexpression of ADGRE1 (NM_001974) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ADGRE1 Cytosection
TS413462P5

USD 889.00

4 Weeks

Transient overexpression of ADGRE1 (NM_001974) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ADGRE1 ICC Control Sections
TS433097P5

USD 889.00

4 Weeks

Transient overexpression of ADGRE1 (NM_001256255) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ADGRE1 ICC Control Sections
TS433116P5

USD 889.00

4 Weeks

Transient overexpression of ADGRE1 (NM_001256254) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ADGRE1 ICC Control Sections
TS433151P5

USD 889.00

4 Weeks

Transient overexpression of ADGRE1 (NM_001256252) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ADGRE1 ICC Control Sections
TS434932P5

USD 889.00

4 Weeks

Transient overexpression of ADGRE1 (NM_001256253) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack