APLNR (Myc-DDK-tagged)-Human apelin receptor (APLNR), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
APLNR (Myc-DDK-tagged)-Human apelin receptor (APLNR), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
APLNR (GFP-tagged) - Human apelin receptor (APLNR), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human apelin receptor (APLNR)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
3 Weeks
Lenti ORF particles, APLNR (Myc-DDK tagged) - Human apelin receptor (APLNR), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, APLNR (mGFP-tagged) - Human apelin receptor (APLNR), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
APLNR (untagged)-Human apelin receptor (APLNR), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human apelin receptor (APLNR), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, APLNR (Myc-DDK tagged) - Human apelin receptor (APLNR), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human apelin receptor (APLNR), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, APLNR (mGFP-tagged) - Human apelin receptor (APLNR), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-APLNR Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human APLNR |
Lenti ORF clone of Human apelin receptor (APLNR), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
APLNR HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Rabbit Polyclonal antibody to Apelin Receptor (apelin receptor)
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide corresponding to a region within amino acids 2 and 96 of Apelin Receptor (Uniprot ID#P35414) |
Transient overexpression lysate of apelin receptor (APLNR), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal antibody to Apelin Receptor (apelin receptor)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 284 and 376 of Apelin Receptor (Uniprot ID#P35414) |
Lenti ORF clone of Human apelin receptor (APLNR), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-AGTRL1 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AGTRL1. |
Rabbit Polyclonal Anti-APLNR Antibody (Cytoplasmic Domain)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | APLNR/ Apelin Receptor / APJ antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human Apelin Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Hamster, Elephant, Panda, Horse (100%); Orangutan, Marmoset, Mouse, Rat, Bat, Rabbit (94%). |
Rabbit Polyclonal Anti-APLNR Antibody (Cytoplasmic Domain)
Applications | IHC |
Reactivities | Human |
Immunogen | APLNR/ Apelin Receptor / APJ antibody was raised against synthetic 20 amino acid peptide from 3rd cytoplasmic domain of human Apelin Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Panda, Bat, Horse, Rabbit (100%); Elephant (95%); Platypus (90%). |
Rabbit Polyclonal Anti-APLNR Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-APLNR antibody: synthetic peptide directed towards the N terminal of human APLNR. Synthetic peptide located within the following region: NGLVLWTVFRSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYRDYDW |
APLNR MS Standard C13 and N15-labeled recombinant protein (NP_005152)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Anti-APLNR Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 272-380 amino acids of human apelin receptor |
Transient overexpression of APLNR (NM_005161) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of APLNR (NM_005161) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of APLNR (NM_005161) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack