Products

View as table Download

CHRND (Myc-DDK-tagged)-Human cholinergic receptor, nicotinic, delta (CHRND)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, CHRND (Myc-DDK tagged) - Human cholinergic receptor, nicotinic, delta (CHRND), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, CHRND (mGFP-tagged) - Human cholinergic receptor, nicotinic, delta (CHRND), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

CHRND (GFP-tagged) - Human cholinergic receptor, nicotinic, delta (CHRND)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human cholinergic receptor, nicotinic, delta (CHRND), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CHRND (Myc-DDK tagged) - Human cholinergic receptor, nicotinic, delta (CHRND), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human cholinergic receptor, nicotinic, delta (CHRND), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CHRND (mGFP-tagged) - Human cholinergic receptor, nicotinic, delta (CHRND), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

CHRND (Myc-DDK tagged) - Homo sapiens cholinergic receptor, nicotinic, delta (muscle) (CHRND), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

CHRND (GFP-tagged) - Homo sapiens cholinergic receptor, nicotinic, delta (muscle) (CHRND), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human cholinergic receptor, nicotinic, delta (CHRND), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

CHRND (untagged)-Human cholinergic receptor, nicotinic, delta (CHRND)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human cholinergic receptor, nicotinic, delta (CHRND), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Anti-CHRND Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRND antibody: synthetic peptide directed towards the N terminal of human CHRND. Synthetic peptide located within the following region: LTLGLLAALAVCGSWGLNEEERLIRHLFQEKGYNKELRPVAHKEESVDVA

CHRND (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 175-204 amino acids from the Central region of human CHRND

Rabbit Polyclonal Anti-CHRND Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRND antibody: synthetic peptide directed towards the N terminal of human CHRND. Synthetic peptide located within the following region: LTLGLLAALAVCGSWGLNEEERLIRHLFQEKGYNKELRPVAHKEESVDVA

Rabbit Polyclonal Anti-CHRND Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRND antibody: synthetic peptide directed towards the N terminal of human CHRND. Synthetic peptide located within the following region: RLIRHLFQEKGYNKELRPVAHKEESVDVALALTLSNLISLKEVEETLTTN

CHRND HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

CHRND (untagged) - Homo sapiens cholinergic receptor, nicotinic, delta (muscle) (CHRND), transcript variant 2

Vector pCMV6 series
Tag Tag Free

USD 1,120.00

4 Weeks

Transient overexpression of CHRND (NM_000751) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,130.00

4 Weeks

Transient overexpression of CHRND (NM_001256657) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of CHRND (NM_000751) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of CHRND (NM_000751) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of CHRND (NM_001256657) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack