Products

cDNA Clones (11)
Proteins (5)
Antibodies (1)
Jump to Filters
View as table Download
Claudin 17 (CLDN17) (NM_012131) Human Tagged ORF Clone
RC210920

USD 98.00

USD 390.00

In Stock

CLDN17 (Myc-DDK-tagged)-Human claudin 17 (CLDN17)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Claudin 17 (CLDN17) (NM_012131) Human Tagged ORF Clone
RG210920

USD 460.00

In Stock

CLDN17 (GFP-tagged) - Human claudin 17 (CLDN17)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Claudin 17 (CLDN17) (NM_012131) Human Tagged ORF Clone
RC210920L2

USD 620.00

3 Weeks

Lenti ORF clone of Human claudin 17 (CLDN17), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Claudin 17 (CLDN17) (NM_012131) Human Untagged Clone
SC303929

USD 420.00

In Stock

CLDN17 (untagged)-Human claudin 17 (CLDN17)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Claudin 17 (CLDN17) Rabbit Polyclonal Antibody
TA334195

USD 310.00

5 Days

Rabbit Polyclonal Anti-CLDN17 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN17 antibody: synthetic peptide directed towards the middle region of human CLDN17. Synthetic peptide located within the following region: KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPA
Claudin 17 (CLDN17) (NM_012131) Human Over-expression Lysate
LC415958

USD 121.00

2 Weeks

CLDN17 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Claudin 17 (CLDN17) (NM_012131) Human Over-expression Lysate
LY415958

USD 396.00

5 Days

Transient overexpression lysate of claudin 17 (CLDN17)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Claudin 17 (CLDN17) (NM_012131) ICC Control Block
TB410920

USD 1,040.00

4 Weeks

Transient overexpression of CLDN17 (NM_012131) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Claudin 17 (CLDN17) Cytosection
TS410920

USD 225.00

4 Weeks

Transient overexpression of CLDN17 (NM_012131) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Claudin 17 (CLDN17) Cytosection
TS410920P5

USD 889.00

4 Weeks

Transient overexpression of CLDN17 (NM_012131) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack