Germany
Japan
United Kingdom
China
GJB4 (Myc-DDK-tagged)-Human gap junction protein, beta 4, 30.3kDa (GJB4)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human gap junction protein, beta 4, 30.3kDa (GJB4)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
GJB4 (GFP-tagged) - Human gap junction protein, beta 4, 30.3kDa (GJB4)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human gap junction protein, beta 4, 30.3kDa (GJB4), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GJB4 (Myc-DDK tagged) - Human gap junction protein, beta 4, 30.3kDa (GJB4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human gap junction protein, beta 4, 30.3kDa (GJB4), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GJB4 (mGFP-tagged) - Human gap junction protein, beta 4, 30.3kDa (GJB4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-GJB4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GJB4 antibody: synthetic peptide directed towards the middle region of human GJB4. Synthetic peptide located within the following region: CPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSL |
GJB4 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of gap junction protein, beta 4, 30.3kDa (GJB4)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
GJB4 MS Standard C13 and N15-labeled recombinant protein (NP_694944)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
GJB4 (untagged)-Human gap junction protein, beta 4, 30.3kDa (GJB4)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression of GJB4 (NM_153212) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GJB4 (NM_153212) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GJB4 (NM_153212) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- GJB4
Families
- Transmembrane