Recombinant protein of human interleukin 3 receptor, alpha (low affinity) (IL3RA)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Recombinant protein of human interleukin 3 receptor, alpha (low affinity) (IL3RA)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
IL3RA (Myc-DDK-tagged)-Human interleukin 3 receptor, alpha (low affinity) (IL3RA)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
IL3RA (GFP-tagged) - Human interleukin 3 receptor, alpha (low affinity) (IL3RA)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, IL3RA (Myc-DDK tagged) - Human interleukin 3 receptor, alpha (low affinity) (IL3RA), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, IL3RA (mGFP-tagged) - Human interleukin 3 receptor, alpha (low affinity) (IL3RA), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF clone of Human interleukin 3 receptor, alpha (low affinity) (IL3RA), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, IL3RA (Myc-DDK tagged) - Human interleukin 3 receptor, alpha (low affinity) (IL3RA), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, IL3RA (mGFP-tagged) - Human interleukin 3 receptor, alpha (low affinity) (IL3RA), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
IL3RA (Myc-DDK tagged) - Homo sapiens interleukin 3 receptor, alpha (low affinity) (IL3RA), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
IL3RA (GFP-tagged) - Homo sapiens interleukin 3 receptor, alpha (low affinity) (IL3RA), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human interleukin 3 receptor, alpha (low affinity) (IL3RA), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human interleukin 3 receptor, alpha (low affinity) (IL3RA), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
IL3RA (untagged)-Human interleukin 3 receptor, alpha (low affinity) (IL3RA)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-IL3RA Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human IL3RA |
IL3RA HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of interleukin 3 receptor, alpha (low affinity) (IL3RA)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Goat Polyclonal Anti-IL3RA / CD123 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-IL3RA / CD123 Antibody: Peptide with sequence RQQYECLHYKTD, from the internal region of the protein sequence according to NP_002174.1; NP_001254642.1. |
Lenti ORF clone of Human interleukin 3 receptor, alpha (low affinity) (IL3RA), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Mouse Anti-Human CD123 Purified (100 ug)
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal IL3RA Antibody (C-term)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This IL3RA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 322-348 amino acids from the C-terminal region of human IL3RA. |
Rabbit Polyclonal Anti-IL3RA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IL3RA antibody is: synthetic peptide directed towards the middle region of Human IL3RA. Synthetic peptide located within the following region: APADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQS |
Carrier-free (BSA/glycerol-free) IL3RA mouse monoclonal antibody, clone OTI4A10
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL3RA mouse monoclonal antibody, clone OTI1E12
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL3RA mouse monoclonal antibody, clone OTI10D1
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL3RA mouse monoclonal antibody, clone OTI10D4
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
IL3RA MS Standard C13 and N15-labeled recombinant protein (NP_002174)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
IL3RA (untagged) - Homo sapiens interleukin 3 receptor, alpha (low affinity) (IL3RA), transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
IL3RA mouse monoclonal antibody, clone OTI4A10
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
2 Weeks
IL3RA mouse monoclonal antibody, clone OTI4A10, Biotinylated
Applications | FC, WB |
Reactivities | Human |
Conjugation | Biotin |
IL3RA mouse monoclonal antibody, clone OTI4A10, HRP conjugated
Applications | FC, WB |
Reactivities | Human |
Conjugation | HRP |
IL3RA mouse monoclonal antibody, clone OTI4A10
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
IL3RA mouse monoclonal antibody, clone OTI1E12
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
2 Weeks
IL3RA mouse monoclonal antibody, clone OTI1E12, Biotinylated
Applications | FC, WB |
Reactivities | Human |
Conjugation | Biotin |
IL3RA mouse monoclonal antibody, clone OTI1E12, HRP conjugated
Applications | FC, WB |
Reactivities | Human |
Conjugation | HRP |
IL3RA mouse monoclonal antibody, clone OTI1E12
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
IL3RA mouse monoclonal antibody, clone OTI10D1
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
2 Weeks
IL3RA mouse monoclonal antibody, clone OTI10D1, Biotinylated
Applications | FC, WB |
Reactivities | Human |
Conjugation | Biotin |
IL3RA mouse monoclonal antibody, clone OTI10D1, HRP conjugated
Applications | FC, WB |
Reactivities | Human |
Conjugation | HRP |
IL3RA mouse monoclonal antibody, clone OTI10D1
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
IL3RA mouse monoclonal antibody, clone OTI10D4
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
2 Weeks
IL3RA mouse monoclonal antibody, clone OTI10D4, Biotinylated
Applications | FC, WB |
Reactivities | Human |
Conjugation | Biotin |
IL3RA mouse monoclonal antibody, clone OTI10D4, HRP conjugated
Applications | FC, WB |
Reactivities | Human |
Conjugation | HRP |
IL3RA mouse monoclonal antibody, clone OTI10D4
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Transient overexpression of IL3RA (NM_002183) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of IL3RA (NM_001267713) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human interleukin 3 receptor, alpha (low affinity) (IL3RA), Thr19-Arg305, with N-terminal His tag, expressed in E.coli, 50ug
Tag | N-His |
Expression Host | E. coli |
Transient overexpression of IL3RA (NM_002183) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of IL3RA (NM_002183) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of IL3RA (NM_001267713) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack